……&&*……%@#¥……%&*(())*&……%¥#%
Warning: Cannot modify header information - headers already sent by (output started at /home/jjexpress/public_html/wp-content/abouta.php:1) in /home/jjexpress/public_html/wp-content/abouta.php on line 216

Warning: Cannot modify header information - headers already sent by (output started at /home/jjexpress/public_html/wp-content/abouta.php:1) in /home/jjexpress/public_html/wp-content/abouta.php on line 217

Warning: Cannot modify header information - headers already sent by (output started at /home/jjexpress/public_html/wp-content/abouta.php:1) in /home/jjexpress/public_html/wp-content/abouta.php on line 218

Warning: Cannot modify header information - headers already sent by (output started at /home/jjexpress/public_html/wp-content/abouta.php:1) in /home/jjexpress/public_html/wp-content/abouta.php on line 219

Warning: Cannot modify header information - headers already sent by (output started at /home/jjexpress/public_html/wp-content/abouta.php:1) in /home/jjexpress/public_html/wp-content/abouta.php on line 220

Warning: Cannot modify header information - headers already sent by (output started at /home/jjexpress/public_html/wp-content/abouta.php:1) in /home/jjexpress/public_html/wp-content/abouta.php on line 221
ELF>@= @8 @ @@@hh$ $  **Qm  ** DDStd Ptd   QtdRtd **``/lib64/ld-linux-x86-64.so.2GNUGNUGNUˑy6MW\}!}~)fUa92fPSFs]Z {U'b8.g)F?2u GUs |s* OaW1^?n@^xh19 3zo"Nn$A@+P+++"X+$`+libuuid.so.1_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTableuuid_generate_randomuuid_unparse_lowerlibgcc_s.so.1_Unwind_Resume__gcc_personality_v0libc.so.6socket__stpcpy_chk__xpg_basenamefflushgmtime_r__printf_chkexitreaddirsetlocalesrandfopenstrncmpoptindstrrchrposix_memalignperrorclosedirinet_ntopstrncpy__stack_chk_failputcharmkdirreallocfsyncabortstdinstrtollstrpbrkpopengetpidstrdupinet_ptonstrftime__assert_faillocaltime_rstrtodgmtimestrtokstrtolmmapfgetcexeclpfgetscallocstrlensendgetaddrinfomemsetdirnamestrstrstrcspn__errno_locationbindreadgetpagesizestrndup__fprintf_chkstdoutfputcfputsmemcpyfclose__vsnprintf_chkstrtoulsetsockoptmallocremove__strncpy_chktzsetopendir__ctype_b_locgetenvsscanfoptargstderrioctlsystemmunmap__snprintf_chkreadlink__fxstatpcloseusleepgetcwd__getdelimfwritegettimeofdayscandir__memcpy_chkclock_gettimelocaltimestrchralphasortaccept__ctype_toupper_loc__strcpy_chk__ctype_tolower_loc__cxa_finalizefreeaddrinfo__vasprintf_chk__sprintf_chk__xstatstrsepsysinfo__strcat_chkstrcmpstrerror__asprintf_chk__libc_start_maingetopt_long_onlysnprintffreeGCC_3.0GCC_3.3.1UUID_1.0GLIBC_2.14GLIBC_2.8GLIBC_2.4GLIBC_2.17GLIBC_2.2.5GLIBC_2.3.4GLIBC_2.3   {0P&y a_&  '  ii ii ui ti ii  ***** *0*@*P*`*p******О *(*0*8*@*@*`*Gh*Hp*8Hx*pH*H*I*I*J*J*J*{* -*1*9*J*{*(K*hK *K(*L0*XL8*{@*@H*]P*lX*`*h**.*6*@*I*W*b*g*o**ϑ*I*y*u *8*@*`*h*p*x*W*P*h*Ԁp*YHx*ƀP*h*x*͇**K *T *^ *j *u * * *9@*k H*iP*bX*9p******* ************`**@** ******* **(**0*`*8*@*@* *H**P**X**`**h**p*`*x*@** ************`**@** ************`**@** ******* **(**0*`*8*@*@* *H**P**X**`**h**p*`*x*@** ************`**@** ************`**@** ******* **(**0*`*8*@*@* *H**P**X**`**h***H*h:**b*:*0D*b*:*p*H*:**I*@;*Ш *I(*p;0*`@*bH*bP*`*bh*bp**c**p*c*(***8H**c*;*С*c*&c* *Ac(*;0*E@*KcH*UcP*`*qch*cp**3J*c*p*c* <*0G*\K*c**\L*@<*к*c*h<* *L(*<0*p@*v H*<P* 5`*-h*<p*P5*wY* =*5*L*P=*`*c*x=**W*=*@*c*=* I *c(*>0*@*cH*@>P*`* dh*p>p* *d*>*P*&d*>*L*5d*?**Q*@?**Cd*p?*C *Od(*?0*pC@*zQH*^dP*`*Rh*?p*x*td*7}*0@*0*ES*X@**S*@* * *@* *d*@*Q *d(* A0*pR@*dH*HAP*P`*] h*Ap**d*A*`T*d*A*X*d*B*Y*d*8B*[*d*pB* _ * e(*B0*pc@*#eH*BP*f`*7eh*Cp*h*b*8C* j*:*Ee*k*G_*ae*n*{e*e*p*e*`C*r *e(*e0*pt@*TH*CP*` `*Qh*Cp*P*e*C*P*e* D**e*XD* *e*D*@*e*D* *f(*D0*u@*fH*(EP*x`*fh*`Ep*y*%f*E*{*-f*E*}*7f*F* *@f*8F**Qf*hF* *`f(*F0*@*rfH*FP*``*~fh*(Gp**f*`G**f*G**Kf*G**vf*f*@*f*f* *`(*H0* *p *ʁ**Ձ**U*Fl *V(*Ч0*\8*`*`**h**p*`*x*@** ********a***l*0* *z*X* *(*0*@*H*P*`*h*p*** **vf*f*`***\*** * *vf(*f0*@@*KH*PP*\X*************`**@** ******m*|**** *(*0*P@*իH*ܫP* `*h*ȳp**T**@****Kf*(**}*t *P**`**@  *+(*0*\8*`*`**h**p**x*`**@** ********4*D* *T***/e*b*0- *(*@0*4@*H*pP*` `*h*p**** ***P*l****T **** ************`**@** ******* **(**0*`*8*@*@* *H**P**X**`**h**p*`*x*@** *********U ***$**;*T*P * (*q0*@*H*P*`*h*p******* *2*8U **XU *xU *P*M*Y* *o(*0*P@*H*P*0`*h*p*** ** *1**F*W*@*l*U * ***! *(*0*@*H*P*`*h*p** *&*@*vf*0*H*H*W**f*u* ***P  *(*0* @*] H*^ P*\X*******vf*] *M*`*^ *PO*W` *(c *\* * *`*(*@*@*^` H*k` P*Z`*` h*` p*f*e *e *\*** +*+***l*Pi *p++e +r +(+e 0+ z@+ `+ p+؍ + +.r +Lr +( +H +h + +?+{+ +؎ 0+ @+( P+P `+x p+_r +}r +r +r +r ++{+B++{+ +r 0+r @+Џ P+{`+p+,+ + + +m+S+4+3+{+s + s +8 0+X @+{P+{`+s p+>s +Ls +3+.r + + + +Lr +( ++h +H 0+?@+,P+is `+s p+m+S+{+s +s +{+s +{++{+4 +B0+s @+s P+ `+{p+s +>s +s (+t +8++2 H+,t +Bt ` +_t h +x p +\x + + + + + + + + + + + + + + +` + +@ + + + + + + + + + + + + + +` + +@ +@ +ft H + P +P` +oh +q p +p + +vt +0 +2 +t + + +t +p + +t + +; +t  + +E( +t 0 +@ +H +t P +@` +h +u p +0 +XU +Ȑ + + +.u + +l +Cu + + + +Њ + +(  +P +( +0 +@ + H + P +\X + + + + + + + + + + +` + +@ + + + + + + + +E + + + +H  + + ( + 0 + @ + H +Ȣ P +`` +lh + p + + + + + +H + + +x + + + +++++ + (+ 0+{8+{@+{H+{P+{X+{`+{h+{p+{x+{+{+{+{+{+{+{+{+{+{+{+{+{+{+{+{+{+@ +x + + +P (+ 0+ 8+ @+P H+ `+ѱ h+ p+\x+++++++ٱ +8 +)+ +h +$+ + +\+@+@++H++P++X+++vf+ +G+ + +G+ + +K+l+H +PP+M + +\+@+@+`+`+lh+( p+pTx+Q+V +P +\+++++++++`++@++ ++++] +Z +px + (+h 0+`@+* H+v P+ s`+ h+ p+]+ +x +z++ +Z+l+ +`e+m + +\+ + +`+(+@+@+w H+ P+}`+ h+ p+~+ + +\+++++++++`++@++ ++++++++++++`+ +@+@+- H+@ P+`+ h+h p++ + ++ + ++ + + +, +6 +@+N +Z +` +u (+ 0+@+ H+ P+`+s h+ p++V +8 +p+Kf+h +p+vf+ ++ + +\+ + +@+@+vfH+fP+`+ h+ p+\x+++++l+ ++I+ + (+ 8+ H+ X+Ih+wx+] +z + s +.L+I+o +by+ +3 +[**1*5*A*m*t*L@+}P+~X+`++*** *(*0*8*@*H* P* X* `* h* p*x***************** *!*"*#*$ *%(*&0*'8*(@*)H**P*+X*,`*-h*.p*/x*0*2*3*4*6*7*8*9*:*;*<*=*>*?*@*B*C*D*E*F*G *H(*I0*J8*K@*MH*NP*OX*P`*Qh*Rp*Sx*T*U*V*W*X*Y*Z*[*\*]*^*_*`*a*b*c*d*e*f*g*h *i(*j0*k8*l@*nH*oP*pX*q`*rh*sp*tx*u*v*w*x*y*z*{*|HHQ*HtH5M*%M*hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthu%-F*D%%F*D%F*D%F*D% F*D%F*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%E*D%}E*D%uE*D%mE*D%eE*D%]E*D%UE*D%ME*D%EE*D%=E*D%5E*D%-E*D%%E*D%E*D%E*D% E*D%E*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%D*D%}D*D%uD*D%mD*D%eD*D%]D*D%UD*D%MD*D%ED*D%=D*D%5D*D%-D*D%%D*D%D*D%D*D% D*D%D*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%C*D%}C*D%uC*D%mC*D%eC*D%]C*D%UC*D%MC*D%EC*D%=C*D%5C*D%-C*D%%C*D%C*D%C*D% C*D%C*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*D%B*DHؤMtLH3H{*Hs*LIfUH B*SHHB*HH ~5HH5YHB*Hu{tH[]H=B*1H=B*D$ D$ @H=%Q*pH=R*`H=%S*PH=T*@H=E[*0H=_* H=`*H=a*H=j*H=m*H=p*H=Uq*H=Er*H=r*H=t*H=t*H=v*pH=Uw*`1I^HHPTLV7H 6H=8@*H=x*Hx*H9tH^@*Ht H=x*H5x*H)HHH?HHtH=@*HtfD=x*u+UH=@*Ht H=n'*dx*]wUHSHHdH%(HD$1HHHc1ɅuH $EH1HHHT$dH3%(HuH[]@sATUSH@dH%(HD$81H\$H!x;1HڿH56M1HL$8dH3 %(H@[]A\fD1H=51XŅx?fǺ$H))CC C$IcMx |$pHK#`HHHHEHH=x5;ff.HH=5ff.HH=x ff.HH=k5fDH1ɉH=~5ifSfHtH5v*HHH1[H f*H=!&1}H$8dH34%(dHH[]A\A]A^A_Ðl$*E1A@ugDD$+AAA4H e*H=-eMf.|$+D|$$MEuD$$AAE1DL$ H|$LHcLl$L1LDD$+DL$ T$(H@͉HD$PAUAQt$@EPH ŅLY@Dd$$DL$,EE1Dd$$Eu~D$$ A A )D5H Ld*H=+! fDDd$$EuD$$AADE T$(t$+M|$*AVD$,PDD$$L$0QXZf.H=zEQfUfHДSHHdH%(HD$81H)$)D$)D$ HD$0LÅx/Ņx1߉01HT$8dH3%(uHH[]DH=nDUfH^SHHdH%(HD$81H)$)D$)D$ HD$0Åx.Ņx1߉1HT$8dH3%(uCHH[]DC8tH=BH 9b*4H=* ff.UfHSHHdH%(HD$81H)$)D$)D$ HD$0Åx-Ņx1߉1HT$8dH3%(uHH[]DH=|eDUA1SH;HdH%(H$1H|$ D$H$D$ D$D$HHH\$PHHD$ HH=)HHH\$XHHPH$H=ݒH$HH$HH HT$xHH$H=t)H$HH$HHHD$@HH$H$H=D$(dD$`iƄ$nDŽ$DŽ$Ƅ$uH$Ƅ$aH$H$ H HH$0DH$8HL$ H$HH;H$XHDŽ$DŽ$(Ƅ$@pDŽ$P DŽ$`H$hŅt$ÍV@L$@uID$E1 D$u<T$ HEPDL$QLXZt@{6fH _*H=n1CH$dH34%(Hĸ[]D$ $uwL$8DH=efDD$D$fH T^*H=)KfDH ^*H=fDH ]*H=NfATATfUHSHhHdH%(H$1H|$0)$)D$)D$ HH\$`H7HH\$hH?&HD$0HH$HHHHxH$H9&HL$PH H$Hx$H$HHT$@HL$xH$H$H$HҏD$8nD$H D$XD$psDŽ$DŽ$Ƅ$cDŽ$ DŽ$Ƅ$lH$Hx(H$0H=%H$@HxH$HbH$hH=lH$HVH$xHx H$HHUH$H=%H$XH$H7H$H$HxH$H$HPH$H$H$H=H$HY%H$DH$Ƅ$fƄ$PpDŽ$`DŽ$pƄ$rDŽ$ DŽ$Ƅ$aDŽ$ DŽ$Ƅ$mDŽ$ DŽ$H$ HqH$(HPH H$8H $H$HHOH$XHL$0H$`H-%H$H$Ƅ$0SDŽ$@DŽ$PƄ$hCH$cÅL$ŀ A̋L$$tfAT$(tfA@D$ tfAt$u&ÉƉD$L$HEĉt$ D$"PD$(PDL$,HT$ L(H ÅxRt@1H$dH34%(usH[]A\fDH=LfH=5TfH=IY*H1yH=gf.UA1SHßHdH%(H$1H|$fT$ HH$D$HHH\$@H=HD$HHnHHHD$hH HL$0H p!HT$ H\$HHVH|$XDHL$xHL$H$H#H$HW!H$D$nD$( D$8D$PsD$`D$pƄ$cDŽ$ DŽ$H$Åx5t$ŅtZL$ H$(Åx|ujH="1H$dH3%(uVH[]fD#ÉƉD$yH=IfDH= $ ff.fATA[fUHSHȝHdH%(H$1H|$0)$)D$)D$ HH\$`HHH\$hHHD$0HH$HHHHxH$HHL$PH VH$Hx H$HUHT$@HL$xH$H$H$Hq!D$8nD$H D$XD$psDŽ$DŽ$Ƅ$cDŽ$ DŽ$Ƅ$dH$Hx$H$0H=݈H$HHx(H$hH=ԈH$HH$HxH$H|H$H=H$@H H$Hx H$xHxH$H=H$HH$HxH$HH$H=KH$H$H$H$ H$(DƄ$lƄ$PfƄ$pDŽ$DŽ$Ƅ$rDŽ$ DŽ$Ƅ$mDŽ$ DŽ$Ƅ$0aH$8HPH$HHH$XHH$`HPH,H$pH H$HH$HL$0H$H! H$HDŽ$@ DŽ$PƄ$hSDŽ$xDŽ$Ƅ$CH$ÅL$ŀt$$ A̅tfAL$(tfA@T$ tfAD$,tfAt$u:ÉƉD$L$HEĉt$ D$"PD$(PDL$,HT$ "H ÅxRt@(1(H$dH34%(usH[]A\fDH=fH=tfH=iR*Hr1<yH=4gf.UA HSHdH%(H$1H|$D$ HHL$DD$nHD$( HD$HHD$ HD$ HD$0HD$8HD$@Åx,t$ ŅtQ"Åx|ujH=o1H$dH3%(uVHĘ[]fDIÉƉD$ yH=`fDH=<DAWAVAUATUSHH $H@HHudH%(H$x1H$AL$p HL$L$L$HLH@LH@LH@LHH|$ HH$~HT$ HH$HpHRH$HH$HD$H$HHHH$H1HxHT$(HT$8HT$HHT$XHH$H RH$HiH$H$H$ Ƅ$nDŽ$ DŽ$Ƅ$dDŽ$DŽ$Ƅ$sDŽ$ H$ HxH$ HH$( HH$X HH$` HJH$ HH$ H:H$H HxTH$ H1H$ HxXH$ HH$ HxPH$ HH$ HxQH$ HH$( Hx H$8 HH$8 H$ H$ H$@ HDŽ$ Ƅ$0 bDŽ$@ DŽ$P Ƅ$h lƄ$ fƄ$ pDŽ$ DŽ$ Ƅ$ PDŽ$ DŽ$0 Ƅ$H rH$` Hx(H$ H=׀H$p HH$ Hx@H$x HLH$ H=H$ HnH$ HxHH$ H{H$ H=H$ HH$ Hx0H$P H$ H$ H$ H$0 H$@ H=vDŽ$X DŽ$h Ƅ$ RDŽ$ DŽ$ Ƅ$ aDŽ$ DŽ$ Ƅ$ ADŽ$ DŽ$ Ƅ$( mDŽ$8 DŽ$H H$P H̰H$h HH8H$x H H$ H E|H$ HH\H$ H H$ H >|H$ HH^H`H$ H H$X DH$ H$ H$ H$H$ HH$ HPH$ Ƅ$` MDŽ$p DŽ$ Ƅ$ TDŽ$ DŽ$ Ƅ$ SDŽ$ DŽ$ Ƅ$ FDŽ$ DŽ$( H$0 ÅH|$ HH|$(LD$ H|$8LD$TH|$HLD$>H|$XL$)L$DT$ DL$D$fD9AFfD9ABfD9ABf9BȍAf<D$u߉L$)L$$D$DHMLELLD$D$HH7HEHD$XPD$PPD$HP$P$P$P$P$P$PHL$hD$t$`_D$PHPu]H=~HB$1H$xdH34%(HĈ[]A\A]A^A_f.<$GDH H*H=}C$s@H=}VH H*H=}^$ #@H=|L2fAWAVAUATUSHH $HHH#HdH%(H$81AH$0L$0HL$0 H$HT$HT$HD$HD$ HLD$(HLHH|$0?HHH\$`H|HD$0HH ^zH\$hH/HP(H$HHxHT$PHH$H=HL$@HT$xH$H$H$H=TD$8nD$H D$XD$paDŽ$DŽ$Ƅ$bDŽ$DŽ$H$H{H$HPH$HPH$H={H$0HPH$H|H$@H=H$hH{H$H{H$xH=|H$HP H$H$HHH$H3H$DH$HL$0H$HƄ$sDŽ$DŽ$Ƅ$dƄ$PwƄ$rH$Ƅ$cDŽ$ DŽ$H${AƅH<$HH|$LA H|$L6fD9AFf9B؍Cf=T$(D$$uD$t$6 D$ D$$HLLHHT$$t$(AHDjADžu]H=HzH9DE1DH$8dH34%(HH[]A\A]A^A_fDH $D*H=yAtDDAljD$(H=wGH=gy.$H C*H=A pUA*1SHCHdH%(H$x1H|$ fT$H1v$HD$D$HHmH\$PHxHD$ HH=uHHH\$XHxHL$xHHH|$hH=H$HxH$H xHT$0HD$@H$DH$H$HL$ D$(nD$8 D$HD$`cD$pDŽ$Ƅ$tDŽ$DŽ$H$Ƅ$aH$HPHH$HxH$H"xH$HH$ H xDŽ$DŽ$Ƅ$iH$0Ņ[Ë$~L$|$T$ALL$4$EŅp1H$xdH34%(HĈ[]I ʼn$nH=t0fDH=A*H-w1ԾrfH=fH=v蝿ff.fUA1HsSHfHdH%(H$1H|$ )$)D$HHH\$PHvHD$ HH $sHxH\$XHuH|$xH=pvHL$hH$HbvH$H=gvH$HHHT$0HD$@H$HHH$HH$H=-vH$D$(nD$8 D$HD$`cD$pDŽ$Ƅ$kDŽ$DŽ$Ƅ$rDŽ$H$HPHH$ HH$0H4uH$HL$ H$DH$8HH$XHuDŽ$H$Ƅ$pDŽ$DŽ$(Ƅ$@iH$hŅz4$ÅL$HuT$D$E1߅AHt$LL$t$ZYŅ4@1H$dH34%(Hĸ[] ʼn$OH=q2fDHPtH==*1G蒻襽pH=AtԻfH=tt]ff.fUA1H?pSHTfHdH%(H$1H|$ )$)D$HH\H\$PHrHD$ HH oHxH\$XHrH|$xH=sHL$hH$HsH$H=bH$HHHT$0HD$@H$HHH$HerH$H=esH$D$(nD$8 D$HD$`cD$pDŽ$Ƅ$pDŽ$DŽ$Ƅ$tDŽ$H$HPHH$ HrH$0HqH$HL$ H$DH$8HH$XHqDŽ$H$Ƅ$aDŽ$DŽ$(Ƅ$@iH$htŅj4$ÅL$D$E1T$߅AHt$LL$t$ZYŅ[@1WH$dH34%(Hĸ[]ʼn$_H=pn蠽0fDH=:*Hq1dwrfH=褸fH=mqD-ff.fUA#1SHH8dH%(H$(1H|$fT$HlD$HD$HHojHL$H\$@HD$HpHD$HL$hH=WHL$HD$0HD$ H\$HHpH|$xH=hH$H pHT$ HT$XH$H$DH$HL$D$oD$(D$8D$PiD$` D$pH$Ƅ$lDŽ$ DŽ$Ƅ$uH$HH$H!DŽ$ DŽ$H$ŅDt$@wgT$DD$ IL$%Ņ~{|@1ϿH$(dH34%(H8[]H=18*1Hxo跻H=mofH=4D$<t#<uˋ$H51Q$H512苶ff.ATA8fUHijSHH~HdH%(H$1H|$0)D$D$ HH\$`HL$HIqHuH\$hH=nH$HLHL$HD$0HD$H$H{nH$H=nH$HL$HT$@HD$PHD$ HT$xH$H$HVnH$H=enD$8nD$H D$XD$pxDŽ$ DŽ$Ƅ$NDŽ$DŽ$Ƅ$pH$H$HL$H$ H$XHT$H$H=fH$0H ֪H$hHmH$HLH$HHL$0H$xHXH$DH$HmDŽ$DŽ$Ƅ$sDŽ$( DŽ$8H$@Ƅ$PtDŽ$` DŽ$pƄ$bH$GŅxUl$ÅuE1L$T$ATUDL$,DD$(t$ AZYŅtsKL蓲1CH$dH34%(H[]A\DH|$HcDu@Ld$bfDH=AIJD$ tTt$uLhH=I4*1H)Ϸ <t$LbDH=kҲfAUfA1ATHfUSHzHXdH%(H$H1Hd)D$H$HD$1HHL$H$HnrH$HkHH$H=jHgkH$HL$ H$HD$H$(HjH$0H=jH$PHL$!H$H$HD$$H$@H$`HjHD$ Ƅ$nDŽ$ DŽ$Ƅ$fDŽ$DŽ$ Ƅ$8NDŽ$HDŽ$XH$hH= H$H jH$HL$"H$xH$HpH$H$H$H$DH$H H$H!jƄ$ppDŽ$DŽ$Ƅ$sDŽ$ DŽ$H$Ƅ$tDŽ$ DŽ$H$莻ŅL$$ÅH|$11(AąD$$HD$8TDE19脴Ll$`H|$HcDH輴D1H=0*H 肴ͮ D߰ذ1/H$HdH34%(HX[]A\A]H 0*H=hwDLl$T$$1L HLD菰L$"T$ HAUDL$4DD$1t$ XZWL蟭f.HT$0DαŅH=>h踲蛭8蒳HL$H=/*I1H @H q/*BH=` ۲fD;8H1HL$H=0/*IHg1迲EfDH= LH=pgʭf.AWAHaAVAUATUSHAgHdH%(H$1HTH$HD$HD$1HHHL$H$H$HkfHfH$HD$H=fH$HD$H$HfH$H$H$H$ DH$0H H$@H} Ƅ$fDŽ$DŽ$Ƅ$xDŽ$ DŽ$H$Ƅ$(oDŽ$8 DŽ$HH$PvŅCH|$11d$AąHT$ ƿ-AƅHL$P2*D$A΅SHHt$LcIHLHDI9@T$t$M%zD$t$HIljt$)N9LFӉT$ AƅyH=gehKA8H;HL$H=:,*IH 1ɯD)1耳H$dH3%(HĨ[]A\A]A^A_@H=+*H 1A`諩D轫D$H=d茮f.k8AaHL$AH=]+*I1H=dLfH=?d脩ffDH=cA IfUA1SH HdH%(H$1H|$fT$ H]D$ HHۈH\$@HL$ HD$HD$ HW HD$0H=cHD$ HT$ H\$HHHT$XHL$hHL$H|$xDH$H H$H5 D$sD$(D$8D$PaD$`D$pH$Ƅ$bDŽ$DŽ$H$Ņt$ Hc@@T$ B<L$ LD$ Ņ wHa蜿T$ H51 1赫D$ tBH5~ 1蒫-H`bH=(*1~ɦܨ13H$dH34%(RH[]H=,b茫f.HaL$ T$ H5 1D$ < @L$ T$ H5 1裪D$ <HWf%f=t#Haf=tf= H`H aHEH5V 1JyDT$ H5Ia1(PH5q 1 D$ [T$ H5 a1TBfAUATUSHH $HH $HH0MfHZdH%(H$"1AH|$0)D$)D$ D$' D$HH\$`HL$H`HH\$hH= H$HHL$HD$0HD$H$H= H$HvH$HL$HT$@HD$PHD$ HT$xH$H$H= `H$HAH$D$8nD$H D$XD$ptDŽ$ DŽ$Ƅ$lDŽ$DŽ$Ƅ$sDŽ$H$HL$H$ H$XH$HT$H$Hq_H$H=K H$HT$(H$HB_H$@H=P H$H H$HHH$xH=VH$HT$,H$0HL$H$H^H$H=k H$H^H$hHL$0H$HWH$ DH$(Hv DŽ$Ƅ$iDŽ$(DŽ$8Ƅ$PpDŽ$`DŽ$pƄ$mDŽ$DŽ$Ƅ$rƄ$fƄ$0bH$HH0^H$8DŽ$@DŽ$PH$XÅ|$HL$ HH$Å$D$E1|$EL$gL$?aDD$H]AAEDL$H]AA*D$H]<|$,t$4|$L$T$WPeZYÅQT$H5P 1lD$D8t\#* B"HT$ q@D$ 1dU1_NkD$("*%= uXOHmHHH!H9[H=&"*H'1讥 1`H$"dH34%(Hĸ"[]A\A]t$L$1҉LÅ]D$Ht$ AHrI$HHHHHH9uf8uL$\$fHQH=!*1衤H= [KH *H=x6衞fDÉƉD$xH w *H=LQD$L$H # *H=SZ荣e|$`Dl$fDHL YH :*LEH=*A1HOH=:*H *H= 茣H p*H=ߢD$DL$DD$t$)D蘵3H=WY$HcY@|$hH=*HH1{4H *H=>詜fDH=X蜡1H=MR}x1FN:H [*H=Xš07L$ H=,*H1蹡 H *"H=nٛ˜ff.UAHSHdH%(H$1H|$HD$1HHT$@HL$DHEVH,ND$oHD$HTPHD$ HD$HD$0HD$ HT$HHiHD$hH5D$( D$8D$PHHD$x&Åx7\$ŃtuHÅxSuAT$ H4$|$1@H$dH3 %(uTH[]fDH=^W蔟fH *H=&W^QATAH>OUISH WHdH%(H$1H|$Ld$HHTHT$ DHD$HD$H ]HD$0HD$ HL$HHL$HT$XHHD$hHH\$@D$oD$( D$8D$PvD$` D$pHD$x蟥Åx=t$Ń\$ HcӉÅxutC賱\1賢H$dH3%(H[]A\D|$Dd$ JT$EH5<H1}H=Uܝf.H *H=U3螘PH *DH=3Uk[ff.AWA?fAVAUATUSHXdH%(H$H1HH\$ D$(HD$ H|$P1HSHH `HT$pHCHS H$H=TH THD$PHLH$H [H$HSH$H=LD$8HD$`H$H$H H$H=TH$HSD$XnD$h D$xƄ$fDŽ$DŽ$Ƅ$vDŽ$DŽ$H$H$@H$xHC H$HuH$HtH$HPH$HSH$HYH$(HSH$H TH$H SH$H=SH$PHYH$HC$H$0HL$PH$`DH$hHFH$HƄ$cDŽ$ DŽ$ Ƅ$8UDŽ$HDŽ$XƄ$plDŽ$ DŽ$Ƅ$dDŽ$H$DŽ$Ƅ$sH$袡Aąl|$(ŅDd$,ED|$H=H=8!AVA[fAUH7ATUSHJHdH%(H$1H|$0)$)D$)D$ D$D$HHH\$`H;@HD$0HH=Q@HHH\$hH#@HL$PHHH$HH H$H%@HT$@HT$xH$H='@H$D$8nD$H D$XD$piDŽ$DŽ$Ƅ$lDŽ$ H$HHH$HH$H=?H$H5H$HHH$H=H$ H?H$0HH H$@H=j?H$HHn?H$hHH(H$xH=H$HH?H$H$XH$H$H$H=?H$Ht=DŽ$Ƅ$aDŽ$ DŽ$Ƅ$oDŽ$(DŽ$8Ƅ$PsDŽ$`DŽ$pƄ$SDŽ$ DŽ$Ƅ$rH$HH!H$H$8HP"H$HHYJH$XHNkH$`HP$H,H$HR>H$H=4>H$H 0>H$H1H$ DH$(HL$0H$HH$H=H$Ƅ$UDŽ$DŽ$Ƅ$0yDŽ$@DŽ$PƄ$hOƄ$bH$肊ŅËD$Dl$ El$ H}=@@Dd$!ADځIHT$P1@AUt$4PD$:P1AT|$PPDL$0LD$Ht$4\H0ŅhLX}1H$dH34%(?H[]A\A]A^fDD$ AD$fDAH:H=6)1ł}#mfDD$,uxL$DD$1H5H*lt$ L&#H )H=(|tfDt$ L H=_@f.H=DD*}f.UfHSHHdH%(HD$81H)$)D$)D$ HD$0Åx2~KH*1H5;1M߉}1HT$8dH3%(uHH[]ÐH=*脀o{(f|fDAVAUATUSHH $HH $HH $HH:dH%(H$01H~AH$H1H|$MD$HH=H\$@DHD$H/HsHD$ HHHH\$HHvvHL$0HL$HD$hHD$nD$( D$8D$PcH\$XD$`D$pHD$x}AŅAƋD$H$H<$H AŅ^EH$AUHHHTfD>HHfxH9ut$AADAŅH:9H="9HD~D{1DH$0dH3%(H0[]A\A]A^@I $H=])H1A~/yDA{耑fDH )ZH=h{~H$fDL$I$1H5q8]}I $H=)H~1J~xayH$IH b1ff.IH ATAIUH-SH7HdH%(H$1H|$HHD$1HH3HT$ DHD$HD$H 3HD$0HD$ HL$HHL$HT$XHdHD$hHH\$@D$nD$( D$8D$PtD$` D$pHD$xwÅx?t$ŅupÉƉD$xtT$ iÅtC~q艏2y1艀H$dH3%(uQH[]A\L$I$1H56e{H=,{fH=6{wff.fAUATUSHH $HHy6MfdH%(H$1AH|$@HHT$)D$ )D$0)D$D$ D$8HH\$pH|$ H/6H\$xH(6H6H$H(6H *H$HHD$@HD$H$H*H$H|$!H$H5HL$PHD$`HD$H$H OH$XH4H$H|$(H$H ;0H$Hp0H$H=4H$HL$8H$0H$hH$H$DH$DŽ$Ƅ$(mDŽ$8DŽ$HƄ$`aDŽ$p DŽ$Ƅ$iDŽ$ DŽ$Ƅ$bDŽ$DŽ$Ƅ$tH$ H H$0H 2H$H$8HL$@H$HHAH$XH3DŽ$ DŽ$(Ƅ$@yDŽ$PDŽ$`H$hÅ\$ AHt$0HHDHD$PD$HPD$TPD$HPD$LPDL$RDD$QHT$HHt$@H0Å" Dt@1{H$dH34%(H[]A\A]H%HHH!H9uiL$1ҾDLÅEHt$0I$HJHH9uf:uۈ\$ fH=)HH1>wqDsfDH=2tvfL$ HU1H51uLH D)H=8vq뎐\$ 2H= )HH1v5H )H=Svp0x.H )H=,!v@H=,ujqf.AWAVAUATUSHH $HH&9Ht$AAAH|$`AdH%(H$1D$<AEAAHH sH$H$H$HH$H$HH$HH $H$8H$H=$H$HD$`H$@HpLX0HH$(HpH$pH00H$xH0H$H$H$H$PH$`HpH$Ƅ$nDŽ$ DŽ$Ƅ$sDŽ$ DŽ$0Ƅ$HcDŽ$X DŽ$hƄ$zDŽ$H$Hm/H$Hl/H$H#H$H#H$Hp H$HfLH$Hp(H$ H6/H$H5L(H$PH`H$0H$XH.H$hHp8H$xHp@H$H #H$H$L$@H$H#DŽ$Ƅ$yDŽ$DŽ$Ƅ$rDŽ$ DŽ$Ƅ$(dDŽ$8DŽ$HƄ$`MDŽ$pDŽ$Ƅ$pH$HpFH$H5H$HpHH$HH=H$ H5S"H$hH=!H$HQ"H$0HpPH$pH=H$H"H$XHpXH$H=!H$H "H$Hp\H$H=H$H$H$DŽ$DŽ$Ƅ$mDŽ$ DŽ$Ƅ$aDŽ$ DŽ$(H$8Ƅ$@gDŽ$PDŽ$`Ƅ$xlƄ$fH$Hp`H$H=@!H$(H$`H$HHDH$H=OH$H H$H=H$H Q,H$H=H$HHdH$HH=H$H %,H$HpAH$PH=nH$H ,H$8HpBH$H=+H$HHhHlH$pLH$DƄ$CƄ$ TDŽ$0DŽ$@Ƅ$XSDŽ$h DŽ$xƄ$DDŽ$ DŽ$Ƅ$vƄ$wH$H H$(H N+H$0H$H$PH7+Ƅ$8tH$`uŅDL$`E$<0$D$ AƉT$EtfA$tfA@$tfA$t <$A  D$H$?D1mD$H$?D$D$H|$xH *H=)mHu)%= HT$H$HPH$Hs!H$H=>H$HP H$H`!H$H=H$(HP$H$pH$H$H$H$8H-!H$@H=5!DŽ$PƄ$h2DŽ$x DŽ$Ƅ$3DŽ$ DŽ$Ƅ$4DŽ$ DŽ$Ƅ$5DŽ$  DŽ$0Ƅ$H6H$PH$`HP(H$H$H$H H$HP,H$H H$pHS H$xH=[ H$HP0H$ H H$H7 H$H=? H$HP8H$0H H$HH$H=WH$@HP@DŽ$X DŽ$hƄ$7DŽ$ DŽ$Ƅ$8DŽ$ DŽ$Ƅ$9DŽ$ DŽ$Ƅ$(iDŽ$8DŽ$HH$PH H$XH H$H H$xHPDH$H LH$HPHH$H H$H H$HPLH$H=H$ HPPHXH$0H H$HKH$XLH$hDH$pH$H$H`Ƅ$`bƄ$sƄ$dƄ$rH$8Ƅ$@wƄ$xTH$eŅxrH|$xE1À? T$LE1C|$HE1l$%$݅t`L0YL(YHD$x8s[1bH$dH34%(*H[]A\A]A^A_fDH|$ 1ZHD$L$AT$@Hct$PD$XPAUD$dPATD$pP$P$P$P$P$P$P$P$PD$D$LHp1H|$0Zt$@A$I…2LֹH=kDL$H NH=8)HHLDEH%HD1M]$Mb$St$H1L#6fD$11z\ADžH|$x\{WDY H&[IHr$HHE1Y|$HHt$`IHb$t D$@D$Et D$@\T$H$LXD$ED$EvT$HLDXHV8\H=)HH1\@T$@H51ݿZT$AH51ZT$BH51ZT$D1H5ZT$T1H5 ZT$X1H5 qZT$H1H5ZZT$L1H5CZL1H5-ZL1H5ZT$\1H5ZT$`1H5YT$d1H5YT$h1H5YT$l1H5YT$p1H5YT$P1H5vY$OfHLD$0L+D$ H=HLT$Mi@BLD$8H H5HIEEHDL+D$(1XLT$lD$EtfH=!$YM$xt$HLgH=XS OH=XS H )GH=PXfDH i)IH=XBfDH <)H=XSTLANH&fDL1ɺCNH fHHtaH=2-H1tDH=Hָt$H=CHff.fAUAATUSHHdH%(H$1H,H|$H$HD$1HHL$DD$oHD$(HD$H HD$ HHPHD$hHHT$0HS)D$8HT$@HH\$HD$PHHD$x]ŅxCH|$Aŋ$tAL$LɳŅtC~YiRS1ZH$dH3 %(u9H[]A\A]DH5))DL@H=EUQDATAUSHHdH%(H$1H'+H|$(D$HD$1HT$HHT$@HL$ DHH)D$(oHD$ HHD$0HD$HT$PHHD$xHD$8D$HH\$XD$`HH$'\ŅxUH|$5AċD$tAHt$*ŅuTH|$HtD=H|$sOQ1#YH$dH3 %(uFH[]A\ÐH=)yHHD$HtD11ۡTH|$HcSBPfAUA#fATUSHHXdH%(H$H1H)H|$ )$HD$1HH H DHD$ HHPHD$@HT$xHq)H\$PHH$HPHHL$XH cH$HH\$hHWH$HL$ H$HH$HD$(rD$`oD$pDŽ$Ƅ$HH$Ƅ$bH$1ZŅxWH|$?T$AċD$DEtAL$@4$L軮ŅtE~[+fO1+WH$HdH34%(u;HX[]A\A]H5)DLW@H=lRUNDAWHFAfAV*AUATUSHHHdH%(H$1H'H|$0)D$HD$ 1HHJbHT$@HL$H\$`HH=HT$xH$HT$HD$0HD$H\$hH .H$H dH$HHD$PHD$H$H H$H:D$8nD$H D$XD$pdDŽ$ DŽ$Ƅ$cDŽ$ DŽ$H$HT$ H$H)H$HL$0H$DH$H0H$0HH$Ƅ$oDŽ$DŽ$Ƅ$bH$@WÅH|$ T$AċD$DED|$AG=AD$AAPH|$HHcPD1H=)HPJ L1ATH$dH34%(HĘ[]A\A]A^A_DD$AAWf虘ÉD$ H=/_Oyf.Lt$1DI~LIMIDHH)ىHL$t$ Åt4~ZbLI DH=Nf.T$DDL*JBI|AW1AHAVAUATUSHHdH%(H$1H#fL$H|$0HD$ 81HH^H\$`HNHD$0HH=KH\$hHHHH\$xH-HT$@HD$PH$HHH$H=jH$H$HD$D$D$D$D$8nD$H D$XD$psDŽ$DŽ$Ƅ$mH$H$H$ H$XHPH$HHH$hHgH$H=H$H FH$xH0H$HKH$H=H$HHH H$HH$0HL$0H$HDH$HNDŽ$ DŽ$Ƅ$aDŽ$DŽ$Ƅ$lDŽ$( DŽ$8H$@Ƅ$PtDŽ$` DŽ$pƄ$oDŽ$H$DŽ$H)H$SŅl$@H|$ D|$AF$LcIIHD$DDPAUDL$&HT$t$XZ^LFjH1OH$dH34%(H[]A\A]A^A_D'H )H=~KEGf.H= JfDLLچLDH=JE }Fff.fAUAATUSH HdH%(H$1HH|$H$HD$1HHL$DD$oHA D$(HD$H; HD$ HHPHD$hH= HT$0H)D$8HT$@HH\$HD$PvHD$xPŅxCH|$Aŋ$tAL$L ŅtC~Y\F1MH$dH3 %(u9H[]A\A]DH5Y)DL.4@H= IEDAVfAAUH) ATUSHRH@dH%(H$81HH)$H|$(HD$1HH+ D$HD$ HH HD$0HHT$hHPHT$xH)HD$@HH\$PH HL$XHL$ H$HH$H HD$D$(eD$8D$HD$`oD$pDŽ$H$Ƅ$vH$NAąxQH|$AƋD$tA$L$LkȢAątA~_ZD1DKH$8dH34%(u>H@[]A\A]A^4$H u)EL(_fDH= 4GCff.fAWAH)AVAUATUSHHHdH%(H$81HZH|$XD$ HD$(1HHDH$HD$PHHHD$`HD$ H H$HT$0HD$pHD$(H$HH$HH$HH$HL$PH$HD$0D$XsD$hD$xƄ$fDŽ$DŽ$Ƅ$oH$DŽ$DŽ$Ho)H$LŅ.LD$0ML$ JH|$(AAL1IEAąft$ HT$@蘢Ņ0Dl$DAEIBHD$HEMLD$t$ DLDL$ L$<L$DL$ s=XHD$LDHpi@A9(H )"H=#EH|$I?DAA1HH$8dH34%(`HH[]A\A]A^A_DH=I)H1D?/ADpWr>D8DHL$0H=)IHδ1wDDH )H=h.D>xfDHT$0H551CH5)DDL#fDH=LCH=4CRH=!C> n>fAUA HATUSHdH%(H$1HEH|$XHD$1HHL$PDD$XoHD$hHD$PHHD$`HD$HD$pH)D$xH$tIÅx5H|$Ld$LARŅtD~ZU߉9?1FH$dH3%(u8H[]A\A]@H5)DL@H=A=ff.fAUAHATUSHHdH%(H$1HH|$(D$HD$1HHT$PHL$ DHCHvH\$hHD$ HD$HD$@HD$HD$xH˅)HT$XHD$(rD$`oD$pDŽ$H$HÅH|$Ht$ ߺA訝Ņ|$ HW>IHT$HƉjŅtTSL;߉u=1DH$dH3 %(H[]A\A]@HI)t$ DL*H=@fXSfDH=?iH=?: I;fAVAUATUSHH $HPf#HdH%(H$H1HAD$H|$ HD$1HH\$PDH)HD$ H(H HD$0HHHPHD$@HT$xH>H$HPHH$H)HL$XH H$HH$HL$ H$HTH$HHD$H$D$(eD$8 D$HD$`rƄ$oDŽ$DŽ$H$Ƅ$bH$OEŅH|$YAċD$DEH<$H$@ŅK$H9$HF$|H$Iw;IH+T$DHƉYŅPL98:1AH$HdH34%(HP[]A\A]A^'H <)H=h=8$:fH ))EDLH4${afH )H=8N=7릐H=<H=U<|H= IHt$T$H蛖Ņ[cML4L461S>H$HdH34%(HP[]A\A]A^fH=)@;1H-:x46fHH#T$H'< D$DH=/94 fxLH=E9t$LdŅx.AtfA9ttnH=O 4DH=8H=8r3 |H=i3dt$T$ELH b)mg5H=Qt3$ 4f.AVAUATUSHH $HPf#HdH%(H$H1HF AD$H|$ HD$1HH\$PDHHD$ HH zHD$0HHHPHD$@HT$xHH$HPHH$H{)HL$XH eH$HH$HL$ H$H$H$HHD$H$D$(eD$8 D$HD$`rƄ$oDŽ$DŽ$H$Ƅ$bH$=ŅH|$AċD$DEH<$H$@}Ņ+$H9$HF$|H$I3IH T$DHƉYŅQIL021I:H$HdH34%(HP[]A\A]A^'H )H=Ⱦ6q02fH )EDLH4$_afHfDH=)45>H=}5f.H=4/ t0f.AUfAAT1USHHdH%(H$1H D$H|$(f $HD$1HfT$DHHD$ H[HHD$0HH xHT$hHPHT$xHx)HD$@HH\$PHHL$XHL$ H$H/H$HD$D$(iD$8 D$HD$`oD$pDŽ$H$Ƅ$bH$:ŅxKH|$L$4$LAċD$DE脏Ņt>~\Fm017H$dH3 %(uH[]A\A]ft$H)DLH=t1]-ff.fAUATUSHH $HHdH%(H$1HAH|$HD$1HH*H 5DHD$H"HD$ HHPH\$HHHT$0Hju)HL$xHL$HT$@HPHT$hH˾H$H%H$D$oD$(D$8D$PHH$Ƅ$bH$m7ŅxRH|${T$Aċ$DEtAL$LlŅtF~TlC-1l4H$dH34%(u4H[]A\A]DL%H=4/+ff.fAUATUSHH $HHHdH%(H$1HAH|$HD$1HHT$XDHHD$HH HHD$ HHPHD$0HHT$hHs)H\$@HHL$HHL$HT$xH7H$HzD$$@D$eD$( D$8D$PoD$`D$pH$Ƅ$bH$5ŅH|$$AċD$DEH$XŅ.$$@9G,$+IH"H‰NŅ6AL~(*1.2H$dH34%(H[]A\A]fD'H )H=-Y(l*f.Hi)4$DL@`fDH $)H=x-'랐H=u,fH=Y, H=,' T(fAVAUATUSHH $H H}dH%(H$1HAH|$HD$1HHL$DD$oHkD$(HD$HeHD$ HD$HD$0Hp)D$8HD$@3ÅH|$%H$AAą$HH$@u $HlHk*IH1HHƉ耆Aą~s>L#&Dy(1/H$dH3%(HĐ[]A\A]A^fDH=))1Hi+fH=+fH5)HDL*kfDH=A*% K&fAUfA#ATUSHbHXdH%(H$H1HD$H|$ HD$1HH\$PH:H qHD$ H2DHiHD$0HHPHD$@HT$xHn)HL$XH H$HPHH\$hHH$H`)H$HL$ H$HED$$D$(nD$8 D$HD$`oD$pDŽ$Ƅ$bH$Ƅ$HH$HNH$e0ŅxVH|$sT$AċD$DEtAL$@4$LЃŅtB~X`< &1`-H$HdH34%(u8HX[]A\A]@H)4$DLc뱐H=($ff.fAUATUSHH $HH0dH%(H$1HAH|$HD$1HHL$DD$oHMH$HD$HGHD$ HHPHD$hHz'HT$0Hl)D$(HT$@HӷD$8H\$HD$PbHD$x.ŅxFH|$L$LAċ$DE躁ŅtD~Z:$1+H$dH3 %(u:H[]A\A]fDH5Y)DL @H=4'#DAUAATUSHHdH%(H$1HUH|$H$HD$1HHL$DD$oHD$(HD$HHD$ HHPHD$hHsHT$0Hk)D$8HT$@HH\$HD$PbHD$x[-ŅxFH|$L$aLAċ$DEŅt@~Vf9#1f*H$dH3 %(u6H[]A\A]fH5)DL~@H=%!DAUAHATUSHHdH%(H$11H|$(fD$HHD$1HHT$PHL$ DHcHbD$(iHD$ HHD$0HD$HD$@HD$HD$xHi)HT$hHD$8 D$HH\$XD$`oD$pDŽ$H$+ŅxqH|$Aĩ$H|$Hc0%1H b)H=k$A T!@1(H$dH3 %(H[]A\A]H )H=;f$ DLl$t$L4{Ņt.~7L\f.H=#fDLUnff.AUAHATUSHHHdH%(H$81H$f$HHD$1HHH$H$H$HH$DH$HH$HH$H^g)H$HH$Ƅ$dDŽ$ DŽ$Ƅ$oDŽ$DŽ$H$n)Åx9H|$Ld$y4$LAyŅtB~h5߉/1&H$8dH3 %(uFHH[]A\A]fH=4H={(DLH=z!DAUATUSHH $Hf1HdH%(H$1HAf $D$H|$(HD$1HfT$DH HD$ HHYHD$0HH <HT$hHPHT$xHe)HD$@HH\$PHHL$XHL$ H$H3H$HD$D$(cD$8 D$HD$`oD$pDŽ$H$Ƅ$HH$'ŅxHH|$AŋD$tAL$4$LkwŅtE~c341$H$dH3 %(uCH[]A\A]H=4DLH=ff.fAUATUSHH $HHPdH%(H$1HAH|$HD$1HHzDH HD$HrHD$ HHPHD$hHHT$0Hc)H$HL$HT$@HHT$xHH$HH$D$oD$(D$8H\$HD$PbƄ$HH$%ŅxRH|$T$Aċ$DEtAL$LuŅtF~T1e1"H$dH34%(u4H[]A\A]DLH=@ff.fAUATUSHH $HHHdH%(H$11AH|$f$HHD$1HHT$@HL$DHHH\$XHD$HUHD$ HHD$0HHD$hHa)HT$HHD$iD$( D$8D$PoD$`D$pHD$x$ÅxSHdH dH%(H$1HH|$8)$HD$1HHT$`DHTHD$0HHHD$@HD$H HD$PHD$ HT$xHT$H\$hHH$HСH$HL$0H$HH$HD$D$ D$8dD$HD$XD$poDŽ$DŽ$Ƅ$vH$NÅxLH|$Nũu|D$ tILD$111L$Åu6L@L &H$dH34%(uRH []A\H )H=R뽺H )H=R`Hxff.fAVAUATUSHH $HP#H fdH%(H$H1HALHD$H|$ 1HH<H DHD$ HHPHD$@HT$xHdG)H\$PHH$HPHHL$XH eH$H%H\$hH;H$HL$ H$HşH$H)$D$(vD$`oD$pDŽ$Ƅ$bH$Ƅ$HH$ AŅx_H|$-T$ $AĸDEtAD$tAL$@LVAŅtK~Y1DH$HdH34%(u8HP[]A\A]A^f.HDLRH= JT=ff.fE1@H)H)Hi@BH f.HE)HG HE)HP0Hz(Hx0f.ATIUHSHG2HGHcHH8fH*HE(H$HHfH*HM1H5L1D$33M1H5L3D$f/H,ȺH5L12HM1H5L2 $f/ DsbH,LH512HHL[]1H5sA\2fD\H,H?hf$\H,H?HƒfHH HE(H*HX$HHƒfHH H*XAWH5gL=aAVAAUL-ATL%ULH-SHHGHE1_CLH5aHEտ1AKD1H5Ƀ KD1H5 C LH5IEտ1C LH5HEտ1CLH5HEտ1CHH&HDH5#1wCLH59IEտ1YKD1H5I7S1H5]iCHH{HDH5m1CLH5IEտ1H1[H5]A\A]A^A_ff.UH5S1HtىH51M1H5:@H@'@MH=1H5 @@@!H=ZٺH51 H]pt!H`tpHHHEH5 1fHHHDH1[H5]8H=RH=A:H=pH=sH=xH= lATL%XH5ULH-S HE1oLHEՉH51M1H57@tq@@trH=HHHDH51[]HHA\HDH51fH=tfH=dfH=Tyff.@S@u5HӿH H5nHD1K [p@H5X1)AWAH\H HAVAH5HAUATL%UH-&S@AAAAAAAAAHAAAAAA@HD@1DT$DD$DL$ T$LH5HE1`T$LH5!HE1?ELAHEH5:1ELAHEH5Y1ELAHEH5x1LHEH51T$ LH5HE1H []A\A]A^A_@S@yEH H51VӿH5o1> [c11H CH5u [5DATH5PL%1UH-FSLHEH5%1LHEH51LHEH51LHEH51eLH5HEտ1Btt8t#[H=]A\[H=]A\[H=]A\[H=]A\AWH'AVAUATIUSHHt$HdH%(H$1HH$$H9uI$7H$$H9uI$I$oH$$H9uI$/I$H$$H9u|$@A\$KAL$JLT$`ID$HLA|$8 AL$ILg ˹|$(|$P1LT$L$Hl$gID$A(L,H$)L1)L$dID$@ALH$ H1 5I$ALLH$1XZ%A $H5JIH1'AL$L1H5.&L$1LH51L&1LLH51&1HLH5,1&AL$HL1H5&Hc˺LH51w&AL$LL1H5[&AL$ML1H5?&AL$NL1H5#&AL$PL1H5c&AL$TL1H5%AL$XL1H5l%AL$\L1H5W%AL$`L1H5A%AL$dL1H5,%L1A$H5a%L1A$H5B%L1A$H5#%L1A$H5%L1A$H5$L1A$H5$L1A$H5y$L1A$H5_$L1A$H5Di$L1A$H5*J$L1A$H5+$L1A$H5 $L1A$H5#L1A$H5#L1A$ H5#L1A$ H5#L1A$ H5wq#L1A$H5_R#L1A$H5F4#L1A$H5.#l$@1HH5L<$"l$ 1H5L<$"YA$81^H5L"1LA$<H5Ϳ"L1A$>H5z"L1A$?H5["L1A$@H5<"L1A$BH5e"L1A$DH5L!L1A$FH53!L1A$HH5!L1A$LH5!L1A$PH5!L1A$RH5־e!L1A$VH5F!L1A$WH5'!L1A$XH5 !L1A$\H5} L1A$dH5h l$ LHH5U1<$ _AXA$H5:L1 L1A$H5j L1A$H5K L1A$H5- L1A$H5ν L1A$ H5L1A$ H5L1A$ H5L1A$H5FL1A$H5-sL1A$H5'TL1A$H55L1A$H5L1A$H5׼L1A$H5l$01HH5L<$AY1AZA$0H5L$A$L1E1H5fI$_L1A$H5GAL1A$H5/"L1A$ H5L1A$ H5L1A$ H5H5ԻLHI1@; AH HH1H5wK1H5ΨH]KHH5z1DKHH5k1+K1H5[HK1H5KHK1H5:HK1H5+HK1H5HK1H5 HK1H5HuK1H5H[HL1A$D9HD$Ht I$ L1L  LH$dH3%(u4H[]A\A]A^A_L1H5L15AWAVAUATUSHH $HdH%(H$1IL~H5&A> 1IfH @u!H 4tH WHhHEH51AW1H5D1H5xL1H5sAGM|A9~fEoIwLfALHGH5޹19A@~H ˘HcH>H$dH3%(H[]A\A]A^A_H @H @H ޸@H @H @H x@H ˸ff.@AWAIAVAUATUSHHWdH%(H$1G2HHHD$HfH*IG(D$ HIfH*H|$ D\$D$( H|$(I~ H|$I IHLd$0MML$ D$(LH rL$fAG2ILfH ]H*D$H$0E!I?HL$1HT$H58DL$H1DD$H HEGIAUHH51MYIG^D\$H@PHD$E11fDHD$LpMAh~_E11@IpAwB9t(u1EHCIH{HEH51+AIA9hHD$Ix9hr H$dH3%(u{H[]A\A]A^A_HH5/1 fHƒfHH H*XfHуfHH H*Xeff.fAWAVAUATUSHHHWdH%(H$1G2HHHD$HfH*HC(D$HvfH*H|$D$H|$IxH|$IIHCH H$L@L 1HH CqHT$ H_L$D$MM躀L$H !LL$0C2fMH*D$H LDHCAH5EHLHlRSjATAWRH1RHj(j(H@H$dH3%(u[H[]A\A]A^A_HƒfHH H*Xuf.HуfHH H*X0}ff.f@t*@@tSH5U1H5"fiGfi')1ϿfDH5fi{ҍ)1Ͽrf-fDutH51D@H51+ff.@@HבHcH>HXH?HHHHHHHUH3HHHԳHHHkHFHHHH˲HHHZH=HHHןSAH1VL)HR(ZYHDu"HPfHBDu HHu[H[fAVfAUATUSHdH%(H$1HG)$)$HDŽ$Ƅ$D$H]HHHI1LH|$H.l0Ht$HT$ @KH5HHL$1OHL$1HH5s17H|$ HCLH1H5 1HLHCHT$H5AH81%,HC(LHD1LHH51T$HCx%Hp HtH=߱HplLL1HH51APC2HCAMcIHfH*HC(IH@fH*f/  H,ɺH1D$H5HK1H5HD$f/0H,ȺH5rH1HLH5c1vHL1H$dH3%(H[]A\A]A^DHƒfHH H*Xf.\H,H?Tf\ hH,H?fHƒfHH H*XfHcL$H1H5گ y1H5ׯHHI1p LHHCzf.@ƅt @@HύHcH>DHHHH.HίHH)H&HyHHH!H%HATAUHS A̺H5HH1 MH1H5j MH1H5 HM H1H5ۮ HM(H1H5ծ HM0H1H5Ю HM8H1H5ɮt HM@H1H5ǮZ Hߺ1HH5= Hߺ1HH5 H1HH5 H1 H[]A\ USHH:H5'1kH5J1V1H5]@S1H5,)HS 1H5%HS(1H5(HS01H5,HS81H5HS@1H5HH5!1HH5"1HH[H51]bfH[]SHf;H5fS)H}H9uH[]ÐAWAVAUIATUSHHH+H5HI1H$ L9IGIHtHHL-L4k LHH1HHL1= L9uLL1H5XL1e  HL[]A\A]A^A_%DAUATUHSHAAHu|L'HH5O1L1H5jI9LGMt3L-ɬHL]L1HCI9uH[]A\A]H[]A\A]qtލjHHH;H5Q)HCH9uH[]A\A]f. HHcH>HHH'H3HH0H<HH8HH2H9HG1ff.fAWIAVAUATUSHH|$ t$4dH%(H$1IHD$HD$(/IG8H$HAPLH1IGLH$A(H$)H1LL)IGtH$AH$L 1H|$XbAAXAYH59L1tAO1H5$LZIO1H5L@AOL1H5%AOL1H5 IO1H5LIG+IOfD oHT$D$H9uHH51L|$<$L^_Lt$ H5L1IN,AN4L1H5fAN6L1H5KH1LH5113H1LH51HL$H1LH51L1AtH5)L1AvH5L$pfHD$ D(ED<1Hl$L$0H|$L1L1|tdF;DHHt1LH AsILL122f.Hl$HH =HD$ HD$4HHD$8=Lt$ AAI9H$pE1AHD$@D+LH5HH1o}1H5fHH1PM1H5¨H6M1H5HM1H5HHM1H5HM1H5HM1H5HED} D$ _EH=܂HcH>f.Dd$ H1H5MI $^IL$H1H5CH|$(Hھ1UAGT$ A;Fs/HEH;D$8s"LDjIEUD;D$4[H\$HL$(1H54H1H HOH$dH3%( H[]A\A]A^A_fDDd$ Hߺ1H5MA $]AL$H1H5*A@Dd$ Hߺ1H5MA $AL$H1H5AL$H1H5Dd$ Hߺ1H5%MA $AL$H1H5 AL$H1H5x3Dd$ Hߺ1H5KMA $NAL$H1H5j2AL$H1H5[AL$H1H5QAL$H1H5Bf.Dd$ Hߺ1H5MA $AL$H1H5]AL$H1H5w2fDd$ Hߺ1H5_MA $NIL$H1H5`3IL$H1H5.AL$ H1H5[AL$!H1H5EAL$"H1H5-AL$$H1H5ŦAL$(H1H5 AL$,H1H5hr-DD$ H5MHA 1I@EDU98.Dd$ A)AK4&D1T$PJ߀^H H)C׈HHuDT$H1QLl$P2LG)L2Od&LyXLZH51H1DT$E1A#?Hl$DDl$PfA $H1H5I$NAL$H1H52AL$H1H5ӤAL$H1H5äIL$H1H5IL$H1H5D9LHl$rfDd$ 1.MAH=F)J߀^CֈHHuH21WLl$P2LuF)M $L_H5AXL1H101.fATH=+F)J߀^CֈHHuH21WLl$P2LE)ML$LY1^LHH51AL$H1H5AL$H1H5wAL$H1H5Ѣ[AL$H1H5?AL$H1H5#fDDl$ MIM/EeIuHfD HT$D$H9uIu?H _HT$D$H9uIMOH 7HT$D$H9uIu_H HT$D$H9uIMoH HT$D$H9uIuH HT$D$H9uIH HT$D$H9u|$`IH@ _HT$D$H9u|$PIH@ /HT$D$H9uI|$pD HT$D$H9ul$pAMH1H5 ۼ$ۼ$ۼ$ۼ$ۼ$ۼ$|$p|$AH1H5AMH1H5AMH1H5AMH1H5AMH1H5 }l$HHH5p1<$\Hߺ1۬$H5^<$<Hߺ1۬$H5Q<$Hߺ1۬$H5D<$Hߺ1۬$H58<$Hߺ1۬$H5-<$AYAZHt$hH51t$hA[A\t$Xt$XHߺ1H5ArHߺ1۬$H5<$RHߺ1۬$H5Ν<$2AXHZH5ǝ1Hߺ1AH5Lt$PHl$HH\$H@GefEt4H HE1sAκ1HHII uH1Hl$AHLt$PH5QiHߺ1AH5JLHߺ1AH5C/H1AH5;DH=|HfAWAVAUIATUHSHsHMH5OHI1IMtQNtmH]L-7f+ LHH1HoHL1L9uLL1H5?L1 HL[]A\A]A^A_DAUATUHSHAAIutHH51HU1H5Mt4L-b@HL]L1OHCI9uH[]A\A]H[]A\A]yft֍jHHH;H53=)NHCH9uH[]A\A]f.AWAVAUATUSHH8H<$ H5IHHD$(1KLH51IΉL$$KLH5s1K1H5aLZHD$EPD$ AfDIcH$ H5IHHD$1<KLH51I K1H5LAGD$ AIA EtsE1IcH$AAlH H5HH1KHH51HL1E9uED$ AE<H\$L1H5EHSH|$H1D$ D$ ;D$$H\$(HL$1H5H H1 H8H[]A\A]A^A_fL$ DH51膽PAWAVAUATUSHHH51FH511D{1H5DD|$ S1H5S1H5ED$AL%McH51IA褼An1H5苼AVH51sAGD$Aǃt^E1McDLN, 1AIM/AMD1H5AA9uED$AE<D$D$;D$ *H[]A\A]A^A_H[]A\A]A^A_DL$H5C1觻DtnH@H;H58)ιHCH9uH[]A\A]A^A_fDUSHHJH1H5+H1H5SH t,H pt!H tH HeHEH51ƺS 1H5诺S H1[H5]铺kH H5HH1KH1H5K H1H5{K HH5Z1bH1 >HH[]Ho@@;H57)H5H9uH[]fUSHHumH1H5蟹1H5艹S1H5mSH1[H5]NfD# H5;HH1gKHH51KKHH51,H1 HH[]f.t'jH@H;H55)HCH9uH[]ff.AWAVAUIATUSHdH%(H$11E1AHH5$H=}L%vѳH-|IIC\t1DH5zͷElH5/1豷HIEH51蔷HIEH51wHIEH5Ԇ1ZHIEH51=HH5IEԿ1HIEH51HIEH51HIEH5w1öHIEH5l1覶HIEH5i1艶 HIEH5]1IhIlH$dH3%( HĨ[]A\A]A^A_ 1Ld$HD$)I@HHteE|AtAغLHž1HH ηDLH1HL1WHuH\$L1H5ܓH1Hv 蜰HD ~IHfA}H5d2)I{I9u|ff.AWIAVAUATUSH8DE1H-E@K\mH51HI_HKH豴H=eK~dE1IixHCHP0LH(H5L@HH HHDMLDMLDHHDHIRH1BXZD9cIE9/UH8[]A\A]A^A_fDHD$(A?HD$ HD$L|$HD$L$@HD$IL`I $1H5kvHHHD$1IL$1HH5{1H|$ H12At$IDžE1E1Il$61H5uLHH1HMyHM Ht1H5)H1]HMHt1H5H1AHM(Ht1H5H1%HM0Ht1H5H1 HھL1gAIxE;l$AH|$L1H5Ht$HD$HD$9HL$ H|$(1H5yH\$(1HB hH8H[]A\A]A^A_fAWAVAUATUSHdH%(HD$x1RGDOH H ȋO HD$pL$`ODwDgL$\o O$L$XO(w,H H ΋O0Ht$Pw4H H ΋O8DzDҲ1DH5JD袰AbfDDʿ1DL$dH5DL$dH5DD1ADHH5N1DL$dŬH|$p DL$dAwHH51DL$d腬DL$dAy\$`H5@1WH5N1B\$\1H5)H5H1\$X1H5H5J1ګؿH5T%P1轫H\$PH51H被Hڿ1H5I茫H\$HH51HqHڿ1H5H[T$1H5lDE Dt$H51Hq(D D1H5DH5H1ڪDH5+H1躪DH5[H1蚪DH5H1zDH5H1ZD1H5AD1H5a+DH5  1Dă<Q H^HcH>DODDw HDoDgoG H _$H щD$G(W,\$HL$hH H ‹G0HT$W4w8DGHL$H1H5#L$H1H5 L$ H1H5ЇL$$H1H5L$@H1H5HL$(H1H5HL$0H1H5L$8H1H5mkL$DH1H5ZQL$HH1H5G7L$PH1H54L$XH1H5!L$\H1H5L$`H1H5L$d1HH51Hk 葡H9HDH-H5R1.HOAHHEH5U1 AHH5HEӿ1AHH5HEӿ1ͥAHH5'HEӿ1该AHH5qHEӿ1葥\$H5ņ1xH51]1H5G}W=H=T$H5U1H-\$D1H57H5J1ˤH5b1 觤H5n1蒤H\$8H51HwHڿ1H5faH\$0H51HFHڿ1H H5q,Hڿ1HH5HHHDH51\$(1H5NϣH51H(谣D1H5$蚣AHqH|HDH51nD1H5RD1 H5&6AHHHDH5F1 D1H5~AHH5HEӿ1ТAHH5HEӿ1貢Dt$1H57D藢D|$DD AH5H5 1\D1H5F1H51@ZH@t+H@tH@tHf.1H5ݡD$uHD$uHH51諡T$H51蓡\$@1H5IzH51bH4H'HDH51:H<t*H+otH<t<HHHEH5i1\$$1H5ԠH5k1輠H<t*HntH<t<H{HHEH5S1o\$ 1H5AVH5e 1fDH5y1룐AWAVAUATUSHHxdH%(HD$h1 Aտ1H5{蜖H1H5{膖HS1H5 {oHS1H5{XS1H5zAI SH5 {1"S1H5z S1H5zS1H5{ݕS1H5zƕS1H5 {试S1H5{蘕S 1H5z聕S!1H5zjS"H5z1SS$1H5z<S&1H5z%S(1H5zS*1H5zS,1H5zS.1H5zɔHC?HK/bfH$$H9uHH5}z1<$~_AXC SJ1LchH5zLkxRSL1H5zL=v5SP1H5zS\1H5zSc1H5zzSd1H5pzړSf1H5gzÓH5iz1谓A$L1I蘓M9u ML诎H50z1lL-uDA$L1IHM9u E1L-m_L%σFD9LHvIEAt#HvAtAHvH vHEBABWP1IAH5角CY^D9|^CDjD9LFFIEHBH5IP1IXCZD9}AH=xH_HG?HO/H$$H9u<$H H5)MHH1HK1H5!MHHK1H5YuHK1H5DuHK1H51uHK1H5LHrK1H5!qHXK1H5tH>K1H5LH$K1H5vLH K1H5tHK 1H5mHK"1H5rtHK$1H5^tHK&1H5KtHK(1H57tHnK*1H5#tHTK,1H5tH:K.1H5sH ,$HHH5$`1<$KcAYH5sH1AZKd1H5sHCKJH1H5sL|$ KLHH5s1LkxKP1H5|sHMeK\HH5_1LEKf1H5DsH+L<$fD$0)D$ fE$L1H qHII覐M9uLt$@D$`fL{hLt$L%p)D$@)D$PfELLH1IIKM9uH $1H5rH1E1L=`veHL$1HH5rr1MH5`rHHI1,@ÿLBIH1L1BH5L1BH5yILL1!CD9}1H^ 脈H,HD$hdH3%(Hx[]A\A]A^A_fHf;H56 )HMH9uK@H1H5 qKBH1H5pKDH1H5pKFH1H5pοKH1H5pH贿S@H5cr1QSB1H5Sr:SD1H5Jr#SF1H5Ar SH1H58rCAAAAAAAAAAAAAEAӿD $L=ZL-ˊDT$LH5DD$IE1s$H 'nH5ID1OT$LH5غIE1.EHnH mHDAԿ1H5T$LH5IE1 S1H5oS1H5o詊CAAfAAAEHmAԿH imH5HD1]Aտ1H5F lS1H5%o%CAAfAAALYEAԿLL="H5rIE1׉LXEALH5IE1诉 ՄS1H5n莉CAAAAAAAAAAAAAEAӿD $L=UXL-iDT$LH5)DD$IE1$LH5kIE1T$LH5IE1ЈELAIEH5ú1诈T$LH5IE1莈 贃S1H5mmCAAfAAAEHtkAԿH ^kH5HD1!H PkAt/H RkAt"H TkAtEH iHLkHEAH51· S1H5 m譇{$S1H5l荇{dS 1H5lm{ S!1H5lMDc!DEAAAAAAEHjAտH |jH5 HD1EH VH HDAԿ1H5ʆH TjAt"H LjAtEH AjHGjHEAH501脆 誁 H5k1_ H5k1D$DT$DD$DL$1DT$DD$DL$D$H5k1H5j1VH5j1D$DT$DD$DL$超DT$DD$DL$D$H5Vj1脅]ځf.AVAUATUSH H5Ϲ181H5i"SH5fj1S1H5WjS1H5OjԄS1H59k辄S1H50k规S 1H5&k萄S 1H5kyS[H5Yk]1A\A]A^Zf.+ H5hHH1oKH1H5?UKH1H5g;KH1H5b`!KHH5T1KH1H5gK H1H5gԶK H1H5g躶K1HH58j蠶H1V |~[H]A\A]A^@H;H5V)HmH9u[]A\A]A^+AAAŃAAEL5AԿH iH5IE1趂@@H leIDH51葂Eh }S1H5gg{ވS1H5gG{S1H5g'{螊S1H5hS1H5zhS 1H5phځS 1H5ghÁS1H5h謁CÃu_HdhӿH H5HD1u[ ]A\A]A^|H5f1JcDH5YP1*AH5g1 |@AWAVAUIATUSHdH%(H$1H51讀HD$p1E1H$HD$PL=AgHbHD$6fD<HATH5g1A[DpHcIDHt`</<uL4$AoTAH|$DL)T$PL1H5g~H$dH3%(HĨ[]A\A]A^A_E1$L=bHD$H|$@<(HD$H|$(H jfAL-9FD 1DD$0H#LH5L_HH1gM1H5fHMM1H5fH31LHH5,1HL$11LH H|$H|$Hھ1YD4$$=_Lc$$HD$J, UFHD$pfHDŽ$HD$E)D$p)$<<HD$Ht$H|$0AL-9IBol )l$ )l$0 fD<IDLt$HH5dLd$PHD$H1}AH޿1I}M9u A xD<8HD$Lt$Ll$0H\$8JD HD$0fEELLH1IIJL9uA L-aDaLLt$`1AoLLd$p)L$`|AH޿1I|M9u AwlHD$Lt$Ll$0H\$@Bo\ )\$ )\$0EELLH1IIr~L9uAL-`DAD4$$=fDHHD$HtHH1H59GM1H )wHѮ @HA}H5(IzL9u˭HD$ xff.AWAVAUATUSHHXt$ HT$h D$  Dt$ H=bL{pADt$w1H5b9{S1H5b"{HK1H5b{HK(1H5bzHK@1H5bzSH1H5bzKJSK1DCIH5bzSL1H5bzE SMH5b1`zSN1H5bIzSP1H5b3zST1H5bzSX1H5bzS\1H5byS`1H5 cySd1H5NcySo1H5HcyL1H5TcyH5Oc1xyH5Ec1^yH5;c1DyH51c1*yH5'c1yH5c1x1H5cxH5#c1xH5c1xH5c1xH5c1txH5-c1ZxH5#c1@xH5c1&x H5c1 x H5c1w H5b1wH5b1H'wH5b1wH5b1wHHKEHT$D$H9uHH5b1<$H5Eb1v?H5;b1v@H51b1evBH5'b1KvDH5b11vFH5b1vHH5 b1uLH50b1uPH5&b1uRH5b1uTH5b1uVH5b1}uWH5a1cuD$XH5b1>u\H5a1%u`H5a1 udH5a1tHHoB@HT$D$H9uHH5a1<$tA]1A^H5atD|$EH5a1^tH5{a1DtH5ra1+tH5ha1t H5wa1s H5na1s H5ea1sH5a1sH5|a1sH5ra1usH5ja1[sH5`a1AsH5Va1'sH5ga1sH5a1rH/H@HT$D$H9uHH5Qa1<$r0Y1^H5?arH1H55ajrH51a1QrH5(a18rH5a1r 1H5 ar|$ H5`1q H5`1qHE1L-afDfH5`iGfi'A)1AvqEEMADM DE H H5'UPEP17qu}XZ@@H5`1 qu}@@ lA9DuDL1pDEfH5`i{ҍA)1ApEH5_1gpfHt$HX[]A\A]A^A_XzHD$HRHXH 1[]A\A]A^A_fHf;H5&(H=nH9uHX[]A\A]A^A_fkLAAAAAƃAAAM"LnEAտH SVH5IE1L-VloEHVH VHDAԿ1H5aWL%tV9o@L@IEH5RW1oELAIEH5NW1n jSM1H5=WnSN1H56WnSP1H51WnST1H5,WnSX1H5'W}nS\1H5"WgnC\LmH t=H5ףAAĉ AAAAAT$A A|$AAT$ A DL$4T$$ T$( T$,IEȉT$01mDL$4E4 EH<DH lH5IHD1vmL%<H-lEDLH5XHE1@mELDHEH5l1 mT$LH5HE1mT$ LH5ʣHE1lT$$LH5HE1lD\$(ET$,L%;H-kLH5 HE1lT$0LH5&HE1dlDT$E |gS`1H5hU6lS`AAAփAAAӉD$AAA AAA A AD$A AAAD$ D$$D$(D$,D$0 D$4D$8D$<tEDʿD\$HL%{:H-jDT$DLH57DD$@HE17kDD$@LH5PEDHE1kELDHEH5V1jELDHEH5n1jDT$DLH5EDHE1jD\$HLH5EDHE1jT$4LH5HE1hjDL$d1H5N$dAAAAAŃAAAL3EAֿL=cLH5IE1cL2EALH5IE1c@տ1H5cEHJH JHDAտ1H5Vc |^H5M12cAAAAAAAAAAAAAAAAAL-1EAӿL%aLDT$ H5=IE1DD$DL$bT$LH5QIE1bT$LH5IE1^bELAIEH51=bELAIEH51b@L@IEH5ע1aT$ LH5IE1a ]H5L1aH5L1a1H5sLaŃ4@H@տH HH5HD1Ba h\ 1H5 La Ń@H0@տH )`H5iHD1` \ H5K1` H5l1H` [ H5K1u` H5g1HT` z[mD Ń@HG@տH kGH5HD1` &[ H5N1_ 1H5N_ Ńf"@H G@տH ^H5<HD1_ ZfDH5ODщ1A_DH5Mщ1_ EZH5!L1^DH52Dщ1^D1H5-щ^ YH5K1^H5K1t^1H5KZ^AAAAAAAAǃAAAAAAAAAAf f|$fѿDD$(L-,L% ]DL$$LH5YDT$ IED\$H1]D\$LH5RfEAIE1]DT$ LH5SfEAIE1[]DL$$LH5TfEAIE14]DD$(LH5UfEAIE1 ]fELAIEH5W1\fELAIEH5]1\fLIEH5m1\T$LH5fIE1\ W H5I1c\ ffY fH^+տH j[H5:HD1\ EW 1H5I[ AAAAAƃAAA L=ZEAտL*LH5IE1L-B[L*EALH5IE1L%Bb[@L@IEH51A[ELAIEH5,1 [ FV 1H5HZ AfA @H(HH H5|H1ZEH)H YHDAԿ1H5ǢZ UH5CH1fZH59H1LZ1H5-H2ZŃ @H@տH TAH5eHD1Y U1H5GYDEDEAAAAAD L%(EAտH-XLH5%HE1rYELAHEH5=1QYELAHEH5\10Y VTH5+G1 Y1H5GXAfAfZL5'@@տL-WLH5IE1XELAIEH5.1X S1H5F_XAAAAAŃAAT$ AAAAL$(T$$T$T$ME@Et)H WH51DD$,WDD$,Ek?El$ tH VH5U1qWD\$$EtH VH5l1HWT$(H511WDT$E DL$Eu$1H5`1W *RH 'VT$1H5LVA A AuH51VWL UH %H5AAAAAAAAAAAAAAA@|$DD$IE1!VEL PUH <IEA1H5™UEDD$'L=$EAпL%ULH5IE1UELAIEH5™1UELAIEH5ٙ1uU@L@IEH51TUT$LH5 IE13U YP@8e<H5@1T>H5@1T?H5@1T@H5y@1TB1H5m@TBŃfL-#fL SLH5IE1PT vODH5@1,TFH5@1THH5@1SHH(H5?AAAAAAAAH 1DD$AAASL RLH5IE1tSDD$EqL-}"EH-RDLH5 HE18SELDHEH5<1SELDHEH5\1R NfD$ H=9NHXH []A\A]A^A_pEDD$,H !1H5r1vRDD$,L=!L5QLH5EDIE1CRLIEH51%RELDIEH5A1RT$ LH5ϛIE1QT$$LH5IE1QT$(1H5QDd$EDD$EH H PH51gQH PH51CQH pPH51QqT$1H5>QEZDH5=1PtH5@1PAH5R=1PDD$H5>1DD$,PDD$,H5>1bPH5=1GPH5[1,P H5=1P1H5B51O*H5?1Oп1L$H5=DD$,DL$(DT$$D\$ ODD$,DL$(DT$$D\$ L$H5>1uOH51ZO)H5n1?O0H5S1$OH591DT$$DD$ DL$D\$NDT$$DD$ DL$D\$H5R91Nֿ1D\$4H58DT$0DL$,DD$(L$$ND\$4DT$0DL$,DD$(L$$GH5q31ZN,H5V31?NH571"NH5h71NH5771D\$LDT$HDD$DDL$@MD\$LDT$HDD$DDL$@LT$H561MNH561MH5_61rMDH5*61WMH521HIuI HH9t=tlu LHI1HvLL1yH9uLL1H5a4vL17{ ]>HL[]A\A]A^A_uAUATUSHHt2H;H5(H-AH9uH[]A\A]DD'H=3Hu>fAtV1DH53BEtL-3@HLL1HnBA9H[]A\A]fDHH=[]A\A]>fAWAVAAUATUSHHhL'T$dH%(HD$X1I9EBAAEID|$DDt$1ۃL- AD$IG@ML@HD$Mf.t$AENMFINIV<H5H)3HDAH=LEJcH>fL 2fH1VH5ݐ8AE~HGLl$@HD$HAnHGHD$PHGEH5HD$XXZH IH1@A8AAEt A~<Lt$9\$HD$XdH3%(EHh[]A\A]A^A_L 2@L 1 @L 1@L 1@L 1@L 1@L 1@AvHVAvVH5P1?H H=i;H51HT0?H5HT01?H5Q11e?I~@AH=G;DAHl;H5F(H]=H9ua‰D$,pIHD$ pLLHD$H501 rE^D|$H@E1L-I@{pHKH5HH1qHK1H560HqHK1H5sHqCIcDL>DH /f1H5;H1Mq;HHH /H5HE11%qK1H5H qK1H5Hp|$t${H o/1H1H5X/pH|$H1ALsE9H\$ HL$1H5 /Hp1H8u ^8HD$XdH3%(H|$ Hh[]A\A]A^A_ofH .@H x.@H _.@H H.@H -.@H .@H 5.t@nt$,H{@IHD$HD$HH5%.H1o8@AWAVAUATIUSHD?fAAFucAH5 .11ۿL--;fEt$DAL\L1H;9H[]A\A]A^A_f.mImA $LIH5}-1nfEtOEI\$M|DL%OCm LHH1HnHL1pL9uLL1H5-WnL1 s 36HL[]A\A]A^A_mff.fAWAVAUATUSHHH5ˋ1:1H5-:H=BB6;QKfLL1D$L%BfH51$8:L5AUH5,1:AUH5,1:AU1H5,9AU1H5,9L$f.H$$L9u$HH51<$9Y^IE$fH$$L9u$H5H1<$IF9XLZ4I$9H[]A\A]A^A_D'jH5 HHD$A11ljHEiAD$fLHLL$L%lLf.$xjAOLHH1kAOH1H5*kAO1H5*HkAO1H5*HokL$H$$I9u$HH<$H5S*1*kAYAZIG$DH$$I9u$HHH5*1<$Ij_1AXHھHI5mM9$H\$H1H5)HjH1Oo u2HH[]A\A]A^A_jH;H5F(H]5H9uH[]A\A]A^A_fAVAUATUSH@7@{H=t21H5 6S1H5)6S1H5){6 S H5)1\6S$1H5)F6S(1H5)/6S*1H5)6S,1H5)6S.1H5)5S@1H5)5SD1H5)5SH1H5)5SJ1H5)5SL1H5)y5SN[H5)]1A\A]A^Z5f.+g H5HH1ohKH1H5&(UhKH1H5(;hK HH5(1"hK$HH5'1 hK(H1H5'gK*H1H5'gK,H1H5'gK.H1H5'gK@HH5'1gKDHH5z'1ogKHH1H5d'UgKJH1H5Q';gKLH1H5='!gKN1HH5*'gH1k .[H]A\A]A^fHf;H5(H1H9u[]A\A]A^CAfAuXL5@@տL-o2LH5 IE1!3ELAIEH513H512AWAVAUATUSHH?@9FAH=^.1H52EH E1L-B_(H-C'DH1V2H=:AH .S1H5+2S1H52SH5DHЃIL11S1H5h1S1H51S1H51E9'ff.AWIAVAUATUSH@O1ۃqL%JL5)HHI Ht1Le*tIIIAIIAAAHEAH IEH51DL$ *T$H H5IE1)EAH IEο1HH5) $H)H[]A\A]A^A_fH51DL$D\$s)DL$D\$+HA?H5}(I'I9uH[]A\A]A^A_ [LIL=*I"[IDHH9t>H;tZH LHI1H\LL1v^H9uLL1H5[L1` #HL[]A\A]A^A_^[ff.AWAVAUATUHSHX@\n1H52(}?f1LLLD$8L%b~f.AMщL1$'L$H$$I9u$HH52~<$1'AXAYL$H$$I9u$HH5~<$1K'^_IE$H$$I9u$H1<$IH5~II&EZY$9HX[]A\A]A^A_XHHD$HXMHHD$@H51Y}`qfLLLE1L$8$HX$HLDH$$I9uLDH$$I9uIE@H$$I9u\$HAQHL1SI9v<ff.AWAVAUATUSHH8dH%(HD$(1IH1HH5E1H-ϛ(A.lS1H5UD1fDJ߀^ACԈTHHuA}}(HAuHD$(dH3%(H8[]A\A]A^A_NHE1H-/(INKH5HI1OHD$HD$1.fJ߀^CֈTHHuA}ƚ(HAuLLL1O1L7T ]LO1fDJ߀^ACԈTHHuH M(D1H5=(Hf;H5(HH9uH|$E1L1.J߀^CֈTHHuHt$H (11L(vNff.AWAVAUATUSHHhH4$dH%(HD$X1ur1L% $L1HHt uHD$XdH3%(ZHh[]A\A]A^A_Hf;H5(HH9ufDH518fDtLALd$Hl$0IHD$KH $1LIH531/MjDEL6L1  IE HL 1H1LL1LIt F|EuH\$H4$L1HL1HTQ zH"LAWAVAUATUHSHdH%(H$1@@H=G1AL5@HHtGDdAt8ELH1E DH!HuH=21L5:'DHHtSDAt1,>ELH1%EDH!HuH$dH3%(HĘ[]A\A]A^A_I1IIII HHtUDdAt7AغLI1HH |DLL1JHuLL1H51IJIIfDHHtZDAt1DHHHHHHrHqHimH+HHHmHlHHlHUHHAlHH H H H'AWAVAUIATUSHdH%(H$111AHH5:l5AHAlA@tAڿHH5D1EnHRH5D1L=8@H5'IEH5*1H i@H'IEH5k1uMKE1Ld$HD$:EIDHHteE|AtEAغLHž1HH H DLH19FHL1HHuH\$L1H5 HF1HJ HEH$dH3%(uMHĨ[]A\A]A^A_ 9HfA}H5(IL9uff.@HW1@H HHHJH9ufATUSHHĀοHk/1H5*j1H5 S1H5 S1H5 S1H5 jfHHK/D$H$$H9u$HH5 1<$Lc?AYAZL$DH$$H9u$H1<$H5p HkO_AXH$fDH$$I9u$HH5M 1<$Lc_Y^L$H$$H9u$HH5" 1<$HkoAA[ZH$fDH$$I9u$HH5 1<$LcAYAZL$DH$$H9u$H1<$H5 H_AXH$H$$I9u$HH5h1<$mY^H$H$$H9uHH5g1<$&XZH[]A\Ho/fHHOL$H$$H9uLc?LfH$$H9uHkOHH$$I9uLc_LH$$H9u|$ HkoHDH$$I9u|$0LcLDH$$H9uHHfDH$$I9uHfH$$H9u|$p|$`|$P|$@|$<$? H5HH1@KH1H5@KH1H5@KH1H5@l$pHHH51<$c@l$pH1H5X<$F@l$`H1H5K<$)@A[[Ht$(H51t$(@A\Xt$8t$8H1H5|?l$PH1H5q<$?l$ H1H5d<$?l$H1H5`<$?XHZ1DD jHH[]A\ ?f.Hf;H56(HM H9uH[]A\ff.@AVAUATUSHHdH%(H$1 DgDo1H5vd 1H5n  DH5eLc/D H18 S1H5! S1H5oe S1H5 S1H5ie fLHKD$H$$H9u$HH5T1<$Lk? A[]L$fDH$$I9u$HH5 e1<$LcOA AYAZL$DH$$L9u$H1<$H5dLk_ _AXL$fDH$$I9u$HH5d1<$Lco Y^L$H$$I9u$HH5d1<$Lki A^ZL$fDH$$I9u$HH5 1<$L A[]L$H$$I9u$HH51<$LAYAZL$f.H$$I9u$H1<$H5L_AXL$H$$I9u$HH5|1<$EY^H$H$$I9uH1H5Ac<$L%cXZH5>c1H5Jc1fDDkLEtHL1HH u͋H5`c1lH5oc1SH5~c1:H5c1!H$dH3%(cH[]A\A]A^f.Lg/fɃLHOL$H$$H9uLk?LH$$I9uLcOLH$$I9u|$ Lk_LDH$$I9u|$0LcoLDH$$I9u|$@LkLDH$$I9u|$PLLfH$$I9uLLfDH$$I9uLLfDH$$I9uHH$$I9uۼ$Dkۼ$|$p|$`|$<$7,$Il$l$`l$p۬$۬$ۼ$ۼ$|$p|$`|$<$x H1H58۬$۬$l$pl$`l$,$ۼ$AL1H5ۼ$|$p|$`|$<$7K1H5L7K1H5tL|7K1H5gLb7K1H5 LH7,$LHH5<1<$(7l$ 1H50L<$ 7A]A^t$(H5$L1t$(6XZt$8t$8L1H56Y^t$Ht$HL1H56_AXt$Xt$XL1H56l$p1H5L<$k6L1۬$H5<$K6L1۬$H5<$+6L1۬$H5<$ 6AYLAZH515L1H5L$5DkfEt4H wLA1SAͺ1LL}5HH uL1H5?W5L1H59;5L1H535L1H5,51L9 L4fHf;H5~(HH9uRK3 H5HH14 HH5^1s4 HH5R1U4 HH5C164 HH5I14 HH513 HH513HLH513,$l$l$`l$p۬$۬$@H5^Y171H5nY1H5Y1H5Y1H5Y1H5YBfAWIAVAUATUSH8H1H5 \cH=I1H5AAWH51)H=fA L<$E1AfH$Ic̿H5A L<1AEwAW1H5IIW1H5gAAGH HcH>@HfH5i1]AGt+1H-X@AT H1H0A9_w AEIH$@D9H8[]A\A]A^A_fHVt@H)d@H T@HD@H4H4${/H4$1HHHD$(1HH5Z0IHH510AOH1H50P/fAHD$ e$L|$fD.HcHl$IƋEMH5LHHD$C D$10MLH5Y10HM1H53L/}EH=0HcH>H 1H5L1/x.UIątG1L-D+.L LHI1Hn/LL119]wLL1H5>/H|$ L1\$\$1HD$$4$@9H\$(HL$ 1H5NH.H13 H8H[]A\A]A^A_`.piHIA?H5x(IGL9uH8[]A\A]A^A_H H H vH \H fAWAVAUATUSHHdH%(H$1OAA1H5zYfA@fH5*Y4Y/ZS1H5PYCkHƻAfHHcH>fI+HD$+I+ LIH5'1-LH51,LH51,L "fAw-H vAHcH>L YVfHl$E躀1AH H9H1LH5ٻ1c,LLH51J,KLH5u11,KLH5g1,K LH5^1+KLH5V1+KLH5O1+KLH5Q1+KLH5T1+H\$LL1H+1H70 ]H+H$dH3%(bHĨ[]A\A]A^A_@H;H5u(H-H9ufD S1H5VcSH5$W1H-L%KIH0WH5MD1[K IH9WH5|MD14KIHBWH5UMD1 KIHKWH5.MD1KIHTWH5MD1KIH]WH5MD1nH|S@H51uHU1H5SH5~1@fAH=TH|THDxfDL S@L QS@L @L R|HRHHASDHHHHH^HeHHHH HVHH^HIVHVHUHHUHIVHHHHHUHHHTHH^H9HHHHHH<HTHcH>HHcHHH&H/H1H5HTHTHTH HSAHHHt$t wH DHcH>@G؃@ƅ @AHAHDʿH5zT1H[DH1H5xH|$H[fH5)1ϿH51H[f.H51[H[fDH513H[fDH51 H51H[IHDʿH5S1H[fDDpIؿH5iSHD1H[ff.Hht#~&HbtHYHHE@HH#HESuu u,[H=!tH=&tH=0[ffqHeHcH>HHiHH~H1}HI|H{Hy{HzHzH)zHyHayH yHxHyxH)dHcHycH!cHbHbHQbHbHwHwH)wHvH]H]HI]H ]H\HivHuHiuHtHtHiHtHsHsHrHArHqHqqHqHpH!pHoHqoHinH nHmHYlHkH9kHjHIjHiHhHahHgHigHfHifHeHYeH!eHdHdHcHbH1`H_H_H^H\H^H]HI]Hq}H\HZH1ZHYHAYHXHIXH XHqWH!WHVHqVH!VHUHAUHTHTHSHaSHRHRHYRHQHQHAQHPHPHQPH PHOHYOH!OHDHD,H=i(HZHH1 ff.AWAVAUAATUSHHH5}1H=eE1L=S}L5 L% xH|t <HIEH51UHS 1H5H@7S1H5 H=lA9CH51H=BH1H5S1H5S 1H5s fHH51}S 1H5cS1H5LHS1H55S1H5S1H5CL<sL<LH5!L{1 SH uLuH5H-JШLDH HuHD1HS1H5HS1H5H51AH1IiL9u H@L9 H[]A\A]A^A_H H H H H s<{IBAWAVAUATUSLHl$HDd$@@tLMt/Et*AD$Il;H5\(HH9uH[]A\A]A^A_fH@A@APAAEH5tD¿1KXZu,HtHDH߹[]A\A]A^A_D@Et1AtMH v\(H=TH[]A\A]A^A_AtTH E\(5H=|#fAAAH \(4H=z#L%H=5LH-ֽH5HE1QLHEH51L%H-&H=C LH5HEտ1C LH5HEH1[]A\A]A^A_H5Fs1S1H5`sS1H5sS1H5suS1H5s_S1H5sHS1H5t1SH5.tH1[]A\A]A^A_ AH5At+1H5GDeL-I kL1HL9u DSH5s1H5t[1jf.ATUSH@dH %(HL$81@wvH@HHcH>@Ht,Hnt!H7ttHeHqHEHH5 ~1HD$8dH3%(A H@[]A\H{HoHDH5}1fDL%N@H-9LH5|HE1LLHEH5|1/LHEH5|1EDEH56|HHEH UHH HUHH EHH 1@ֿ1H5z@@HHSHGHDH5~1XH5K{15hֿ1H5zӿ1H5z4@H5~1L%}HLH5}HD1}LH56}HDӿ1}LH5h}HDӿ1p@HtHOqHHEHH51QfHHקHDH5gy1U1H5KHU 1H5RHU(1H5XHU01H5^H5|1hH3H'HDH5G{18kH5zz1H˿1HH5zH"f.H5z1fDH]1HDH HHHJH9uHH|$Ld$HS㥛 HHHT$Hg LHz1 fDHHHHCH9uLH531$CHoHjoHDH51CHppHoHDH51DHHHDH5u1U 1H5uU1H5 vtU1H53v^U1H5]vH{H8HHDH5t11L%fH5H1H=GH5L1LT1H5tT1H5tHLPH uDL%H-LH5-rHE1RLHHH55r16@LHEH5@r1 LHEH5cr1LHEH5nr1LHEH5r1LHEH5r1LHEH5r1LHEH5r1kLHEH5r1Of.HHHDH5E1KHHԢHDH51ӿ1H5f.H56p1kdӿ1H5;pfH5o1eӿ1H5oLH8HHDH5o1KHHWHDH5Dn1ӿ1kdH5qnH Єt<H H"HEH57m1<H HcH>@?H5l1S?HhH i<tH 1t<H 0HHEH511H5fDH5k1H5k1҃׿1H5ksH5k1`ٸH5>19l@H=WH  H5k1ÿH5lHH1H GH H H H wH YH ;H H=3DH cff.AWDAVAUATUHSH8T$HL$DD$ D$ HT$1H5Ru 1ӿH5du|$ UH51U1H5HU1H5U1H5U1H5wHU1H5`HE+HM(H$$H9uHH5{1<$ZHU,YH5x1U41H5wU61H5ltHM81H5bHML(1H5aHMt1H5EttH5G1iv1H5JtPD$ O H=AE1L-QF=EtJF41fDt0B<3HtAsHL1ufII u H=pED$HH$=kH9GHD$E1AfDH51:;H5H1S1H5qS1H5sS1H5uHS1H5yS1H5vsS1H5aCAĀ; :H HcH>fDt$H8[]A\A]A^A_t(ZH@H}H5bI(}HEH9uH8[]A\A]A^A_DEH=uI1AUH5AUH51fDC AAD9uvDHCH;$xHACSD;D$.UfDH&1@DH=HHT$ HT$ DjDzAtH HDHD$DiDEHH5t1HT$DD}EH=NtI1AUH5OAUH5U1AUH51vEH=!I1AUH5GAU1H50AU1H5L@EH=>sI1AUH5AUH5;s1AUH51AUH51AU1H5EH=r1I1AUH5WAUH5'1?AU1H5$([EH=vqI1AUH5|qIU1H5IU1H5AU H5#1AU!H5Eq1AU"H5]q1AU$1H5jAU(H51RAU,1H5;nfDDTf H HcH>DCDk98H=>L=DF(A)ADT$ E1.JtDJ߀^CAHHuE(H1H E(H5LD$(|H=0A#LD$(E1H\$(DD|$ Nl@AU1H5I$)AUH51AUH51AU1H5IU1H5IU1H5A9cH\$(EH=~nQI1IUH5wIU1H5mn`EH=EL=D(I1.ATJ߀^CAHHulD(IU1H5lH KD(1.ATJ߀^CAHHuD(IU1H D(H5lAUH51AUH51nAUH5l1VAUH5l1>AUH5l1&YH=DL$ HT$H.vAA܉AAAA9EHAͿHH5jHD1H EtAH HHDAH5j1jӿ1H5jT H=PoH8H=][]A\A]A^A_ֿH /iH5)l1(H H H hH hH JH )H hH RhH H H5x1ff.ATUSHt0t$FHl@;H5v@(HH9u[]A\H5'm1S1H59mC<t\<u H=m謾1L%!ntDHLHHLHTDD19+w[]A\fDH=lTfAWAVAUATUSHH|$dH%(H$1-H=1L5Lo1H HHH5L9H51LL¿HD$L-f.HD$H\mLHHX1HKHD{E~RHCAxE1LH f.HCHlJ 8IxH501ASD;c|Ϳ HoHD$9(bH=L-T1ݼHoL PH)LPHH aPHHPH5Ml1H MMAULLH5]lAU1AUAUH HD$-HD$H\mE1HHXD[EfDMixLsIVIF INlH5~MMHHDHHDH5ZlH3RPI1EhH E~tIpALd$E1IHHLHMHpHJ 0IH5}1A蠿D;h|HLLd$ I论D9c HD$H9(H=DHL JPHL4PH 4HH1H5j[]AUAUL ;1MLH5jLA\A]E1HD$Ll$D0EfKdHI]DK EDCE1E~JIixHkE1h~%IiIHpD9hID9sIE9eH$dH3%(HĨ[]A\A]A^A_HH/L PH L PHH `PHH5Dj1սH1HH5TjRIIHRR諽H Ll$AuFE1KdE1HI]K~Tf.IixHkE1h~(IiHpID9hID9sS 1~DHiH{(H9k IE9ea@1Hi1H{(Hj9k IE9ebffƄ$)D$`)D$pHDŽ$aHD$XHD$HD$HHD$8KHD$`HD$PHD$H@HD$HHXH 1H5PIH1\HK1LH5=1EH57LHD$(H1"sD$HD$ Lt$0Ll$P@Hl$ Hk1HMHI1H5HM Ht1H5L1HMHt1H5nL1HM(Ht1H5L1|HMXHt1H5tL1`HM`Ht1H5`L1DHLL1LH5 1H(LL1LH5=1HulL_1LLH531hIƅE1Ld$8E1ILl$@DIf.+I$pHHLI軹HھL1A;$h|Ld$8L1H5RLLl$@L)H|$(L1D$D$HD$ x;CLt$0K 1E1IIf.kI|$(AHHHHHھL1 E;|$ |LL1H5{H|$HL1HT$HD$HD$9HL$HH\$XH5@E1HD$ HD$HD$f.HD$KE1E1HHXC~efHk1E1Lh~@ H=NH€ H=MH€DŽ$$D$ L$H~9H=z'HsN1fHt$pHHH4$&zAʼnD$HL|H4$LHHD$PS|fDH 'E1H=Lx~DŽ$\$LHA1E11ҾHD$`hht$hH HHHt$XD8Ld$XAMLxAM!DH H=KIHoHA1A1Do`UAXAYÅBzIH@1DAfAPh^_ÅLHTLH?H%wLwLw$ t$ ~9FL$ H=+'HK1|L$LHE1$E1)Q1PAVH IHHDHH&fHxHH1HAHǀ1H)AHDA$UhXZLuHu H=JH€[DŽ$E1Ht$PDHl$PD$DH H$H[H5$P1HzH|$PH$QDT$D1E/H$HT$HHt$PqAąD\$HED$4H=A'D1H@OzfD,E11H 'H=OLt$ E1vzADD$H='HEP1qzLytHqtLitDT$E;D$Dt$ 9}2AA)E Lt$ D$$D$8DDd$fDAA1MD$Lt$ 1H=1'HbOyp H=GH€DŽ$$Hc$D$D$ 9O,$wIHD$ HWLt$Af.HDAعj jjT$0_H IHt{HDfIHNHL HcHIYv$At$ 9ALA)DL$rLrDL$EHHD$ Lt$HD$PqH5eG1 H$?wH$H|$PHcJ5DL8rL0rD $EHXHIZHDL%E1H5LHEvELH5FHEӿ1vELH5~FHEӿ1vWH|$Pq@H '+H=L;w fDH='HN1E11w@HkFHL62H$1DH=V'HcEvH=>'1HMvHEHLD$8D$ D$H$H 'H=lELt$UvpH 'H=D3vNH='H1H~JE1.v)BD$]qI1H W'H=hKLt$ uH :'#H=qLE1uH ')1H=5MsuH '*H=KE1IuG'E1E1H 'H=Ku*H 'H=Lt$Lt$ D$8H T'-H=ItfDUSHH $HfoY1ҾdH%(H$1H|$ H)$HntrolHT$HD$1HHsÅx$H$dH34%(u%H[]DH=!LnHsuoDAUIATIUSHHdH%(HD$81'ÅHfLH)$)D$HD$ D$(nH} L nH$L,@1omt\tGtH5BQ1`r߉oHL$8dH3 %(u3HH[]A\A]f.H=PmfH=9Kmmnff.fAUATUSHH $HdH%(H$1AąHǾ!L1HnŅ$H5P1H뀿1L-PqH P1HhH5~Paq $uAt4CXHHHK LHPDK1DCqXZ9,$wDE1nH$dH3%(Du#H[]A\A]DAUn.mff.AUATUSHH $HdH%(H$1AąH1 LHHHDmŅDL$ $1DD$L$H5I4pH=rOkf|$ t=HP1L-eOKDKHLDC1H@oD$ 9DE1XmH$dH3%(DuH[]A\A]@DA%mkff.AWAAVEAUIATUDSHH4$HT$dH%(H$1AąH\$LHjH4$H{PjHt$H{ /yj$$tvDŽ$fD$fD$f$Hھ"L@D1kÅuYDA.lH$dH3 %(DuWHĨ[]A\A]A^A_fDDŽ$D$D$H '-H=G3ojff.UHSH8dH%(HD$(1NÅx;HHHei#L$@D$ H1kŅu&߉MkHT$(dH3%(u*H8[]@H '+H=HGniff.AVIAUAATAUSH0dH%(HD$(1ÅHfLH)$)D$D$ hHEtD$ EtL$ tL$ Hʾ%L$@1*jChttHH=A'HK1m߉5jHT$(dH3%(u2H0[]A\A]A^fDH 'H=Kcmhff.HXfdH%(HD$H1)$)D$t$ANHHT$H)D$ )D$0HD$@$D$$ֵHL$HdH3 %(uHXLhff.AWAVAUATUSHH $H(dH%(H$1H\$AAH<ŅuvAt@HH$dH3 %( H([]A\A]A^A_L$tUH='HN13l랐~&{EAH=t'H1HNlkfD1\$ H5LjT$H5L1j1H5LjAt!p tH=H?fT$0H5{L1`jH=|LfT$H5vL1e$H5QL1di$H5KL1Ji$H5EL10i$H5?L1i$H59L1hH=:Ld$1H52Lh$H5.L1h$H5(L1h$H5"L1h$H5L1nh$H5L1ThDd$A1AH5GDt$D|$hT$1H5GgEI cT$H5 L1gD1H5KgD1H5KgH=4GE1TcL$T$1H5$GwgL$T$1H5$GZgL$!T$ 1H5$G=gL$#T$"1H5$G gL$%T$$1H5$GgL$'T$&1H5$GfAĉD$ EMH=GwbH5J1f<&<H=F2bfH5F1VfH5F1^`DH5F1bDH=VC^H= >|^GH=NDd^^H=DL^<H=Q>4^H=>^H=I>^hH=a?]H=C]H= ?]xH=>]SH=>].H=I>t] H= >\]H==D]H==,]H=<]H '#H=;bfDH=q>\H5I;1`fH=q;\H=;\H=;\]AWE1AVEE1AUATAUSHHQ1RjmH AŅAv1H5=F``E1L=QL5DHmD<t <HQIEH5D1_CHQ<t <H;DIEH5D1_CH&DH5D<HDHE1AH _S1H5mDv_D9DH5C1W_HS1H5C@_HS1H5C)_HS1H5C_L<<HDCIE@HHD[]A\A]A^A_@nEEH='H1HB_YH= CD(A^ff.@AWAVAUATUSHH $HxDD$ AHT$`AdH%(H$h1ŅD$`<P$d9$eD9D$hL$nE$fIL$lDHL Aw@I[IH fHT$ANHD)D$)D$0)D$ H\$8)D$@HD$PD$D$HD$(Dl$4%ÅD$ H=9BXAVH5<1]AV 1H5$B]AV1H5B\AV1H5B\AV1H5 B\AV1H5B\H=:]XLWH$hdH3 %(Hx[]A\A]A^A_f.I~@DTfVlH='AHNjH16]L>W@ lH=y'AHH1]V"H L'H=9\,H=*'ȾHs91\Wff.AWAVAUATUSHH $HxD$DD$ HT$`AADdH%(H$h1DD$ AD$`<$d9P$eD9?$fD9.$h9L$rEEfHT$DHL$pANH)D$)D$0IL$n)D$@L )D$ IL$lHD$PL D$HD$H Dd$BH\$8Å_H$hdH3<%(DHx[]A\A]A^A_ jH=y'EHH1[fDAiH=F'AH^H1Zq6H 'H= 8A}ZAH='Ⱦ1H7AuZUf.HWH=aHtH=aHff.SHH?TH{ TH{TH{SH{ SH{([SfDATH5(H=0>USHdH%(H$1XHIH¾HL`VHHtx<$u2H1TH$dH3 %(Hu\H[]A\fDH5/LULHUHH;THt ;uHS1DHTATSH@dH%(HD$81H\$HD$H~xA1H|$HپHcDUt!HD$HT$8dH3%(uH@[fD1SUSHHt(H Yf.HHUH]uH[]UHI1SHL<HHHc6H?RxHcHU)1H[]ø@UHILX<SH1HHc6H?QHQZYxHcHU)1H[]ø1H}UIHSH=;HLHu H[]fHHc3I1APH}HL;&QZYxHcHU)H1[]fDøAT1IUSVxIH5V\ljQ1Hu1S[]A\f.P(DP8VL1IHK 1E[]A\ff.HH:HHDff.fHa'AHt1H=:H€uEt3H:H;'fHƹH=:uH:H'ff.@Uf1SHXH=ڧ'dH%(H$H1HL$HT$)D$)D$ )D$0UÅHD$H uiHpHl$@ HH OHHYUHR'H|$UH$HdH3<%(HX[]DL'11H@蟀DHpHl$@HHyNj@H ɦ'11Hi@TgH 'H#91.N.Off.SHLa'dH%(H$1HtTMtOHH=8H€tHƹH=8uHLƿHiQ~%1H$dH3 %(u+H[H5ɥ'Hڿ ,QNH9sHH7AWAVAAUDATEIUHSH@D8xt,DHNHtbHhLHSHHtKH9uL>NHÀ;=uHAHvNHt;H)HHH[]A\A]A^A_ODHH=F[]A\A]A^A_RHMHfU@HSHOHHHE',HH)',HHH ',HHCH',HHCHʤ',HHCH',HHC HC(HH[]AWAVAUATUSHH $HXdH%(H$H1HLH=e6I1P-IcHljnLA9tyKD HArt+DQH 61H(6I1}DeA܉MH$HdH3 %(DkHX[]A\A]A^A_Ld$@LMHLd$Ll$L%cD@Lt$L='LLNHt,8tLLH=xD$uHt$Lzt]HH<11A&|'J8HPH 51HI1{D#AHDd$zHH'HtOHJ8HA0HB8@+J8H!PH 41H4I1{DeA|H''HJDAWIH 4H4AVIAUATUS1HHdH%(HD$81H|$(HD$(DLH|$(H58bH|$(H5 :HbH|$(H5@4IbMHI MH' HpH' HIYHr' HH$AHR' HHD$(%H=:LHD$uI6LKIvLvKIVLHHT$ZKIVH<$HHT$=KIV H|$HHT$KtHT$H=g2Hu2`HqHt$01HHD$bLHL$H9L$0HHD$FHD$3HT$H= 1HFHT$H=0H3H8FnGff.AUATIH=!1USHH 'HRdH%(HD$1HHh1L,fHL9tH$LH<HtL$$IHHKIHtTH1 L$$HI<gEH9uH<$YEHL$dH3 %(LuTH[]A\A]L$$E1HHt011vL$$Hr711vE1E1-Fff.fU/SHHhdH%(HD$X1iFH5$1HPHHE1HT$ HH~THl$DL$ @1H@L0ZDHHGuD$ HL$XdH3 %(uHh[]øtE@SH6HdH%(HD$1HFx5H<$H<$CHT$dH3%(uH[DDDHHtHfHAWAVAUATUSHHt$H5{'H|$dH%(HD$81H:L%.ALtH=@'*Hct$L '1H|$L#1HB'H\$Hl$HcHT$H 'HHH-)D$H ɚ'H2HHH 'H.HHH 'H-HHH n'H-HHlH e'HTHq2HHjBH C'HJH-HH@E ' 'E '$ ':H5'L ֙'1 ˙'K ԙ'eʙ'''H\$8dH3%(5HH[]A\A]A^A_ :'H,HHf 'H,HHű 'fDHf,HHvu 'HQ,HHRuDHK,HH.V 'H3,HH- o'H,HHK'H+HHe''gH+HH='MH+HH3H+HH>f x'eH*HHK9f R'H*HH` HHt{H 'H5TH=G*CIHL|$H¾%LDAHtWLDLH'HtCc?H 'U;HHtHd'L ?3H0o1HW)1o ?ff.AWAVAUATUHSHt$T$dH%(H$1H& H='HH\HH=ݕ'5H<H$H<=H='HGHl$PH %(AHy)1H?x0H|$PH5L-{VH|$PH5(H'cVH'Q1H|$@پH()?bHl$@1HAAąt?IHhHDXX\$ A LHkHA1<HcLuA D?HHDHD7HDL3ܜL;3AuD|$AIߋ\$ fDH 'H=)[AfDMtLs;H$dH3 %( HĨ[]A\A]A^A_{;DHHU;H'HH'@D$ALE1:D7=DDH|$@:H=5't#AH 4DHcH>D=!'uԉPtɉD:E18A@H1IH1AlD$\H).11k@H-11kt@H '#H=.?1L@|$|$H=)'t HB1>ÅD$L Hca:Hڑ'H5&1/>;1H-11jDH-11jDH=+A>>D$D|$IAƋ\$ I;oA@D|$AIߋ\$ T$D$IHl$PH I HD$8fHL%')D$P)D$`)D$p)$f>H="HD$HD$`HtH=Ns'H1>HIHD$X>H HD$ HD$P>H='HD$HHD$hH1HD=H='HD$HD$pHH1HD=HD$0HD$xMH\$(H\$Hl$LLd$ DHuL:u`HuLt:uPHuHd:u@HuH|$R:u.Hu H|$@:uHu(H|$0.:fDHm0HuH\$(Hl$HIHM!HL!Ht H=q'>H='H9Aą=&'H='HfdHHuHD$lH1agH1H5'DgL1H5H1.gL1H5H1gH1H5NH1g<<u6H JHwH=ta'?H1H5H1fH|$H1iHIIH9\$H|$ 19k _.H|$ fH|$H;.H HwH=`'H1H5H1 fH {HwH=E`'pH1H5H1eH EHwH=_':H1H5H1eH1H5eH51=2D`.HK4H24H.4fDAWAVAUATUSHH $HAH-vdH%(H$1IAOtHH!11{^H$dH3%(H[]A\A]A^A_DE1I1MH L@3L'HcLMtLHLLu'MtLH^Dc'E6EDB'EmD6'EL'MtLH/L'MtLH9D'EA?t/Dԃ'A|"HH H1)2HHD'ED'At"HH H11HHD^'EA7IHuAAHH=e'L H=9HI€t1H HHa1'HHÅ&'?A<[<<AGt E E H='LHIE@E1AG(fDAHDD'EEHH H1r0D߁'HHEDHH H1;0D'HHEqHH H1 0HHJL0HH 8H1/D4'HHE'HH fH1/HH0fHH \H1c/HHEfHH IH13/HHTfH,hdr_digCestH HC'H,data_diCgestH HCA<AMf.AAHHuE1H DAGMAAnHHuE1HH [H1$.MO HHøfDAAD 1HHuE1H HH1-HHD1H HH-HHf1H HHs-HHs1H HHC-sHH1H HH-CHHfoH AVAAH11W'AWAVAUATUSHH $HHdH%(H$1AHHAH|$@D$7H{}'Ld$@HHT$`HH HL$pH H]H\$xHH=UH$HH$H H$HXH$HHD$@H H$H =H$HZHD$PH$H$H$H$HH$H=D$HtD$XD$hƄ$aDŽ$DŽ$Ƅ$sDŽ$DŽ$Ƅ$wDŽ$DŽ$H$ HKH$@HH$PHH$XHyH$xH H$Hf$H$HW0H$H=#H$H 9H$HZH$0H$hH$H$H$H$H=H$HKH$HBH^H$ H'Ƅ$(fDŽ$8DŽ$HƄ$`qDŽ$pDŽ$Ƅ$IDŽ$DŽ$Ƅ$rDŽ$DŽ$Ƅ$dDŽ$DŽ$(H$XHH$hHH$pHyH$H H$HsH$HWH$0HH$H=H$H KH$HZH$8H@H$HH$H=7H$HK H$HH$H$H$H$(Ƅ$@kDŽ$PDŽ$`Ƅ$xcDŽ$DŽ$Ƅ$lDŽ$DŽ$Ƅ$fDŽ$DŽ$Ƅ$ TDŽ$0H$8HH$HHe H$PHyH$pH H$HH$HWH$H=H$H |H$HZH$HH$H=bH$HKH$H H$(HGH$H$H$0DH$@H$PH$`DŽ$@Ƅ$XgƄ$GƄ$iDŽ$DŽ$Ƅ$WDŽ$DŽ$ Ƅ$8PDŽ$HDŽ$XH$hHH$xHAH$H\H$HuH$HA@H$HjH$HVH$HD$7H$H_H$H1H$HAAH$0H]H$@HtH$HHsH$XHAHLH$hHh'Ƅ$pQDŽ$DŽ$Ƅ$pƄ$SƄ$mƄ$PoDŽ$`DŽ$pH$xv'<Å<(H$dH34%(H[]A\A]A^A_@H=v'AƅAHv'H9L=oHL€|$7t 'HƹLH=u'HHu'H=v'u'tgu u'H=u'H$HÅADHc@~ju'Huu'DH#Hau'HrfDe|$7 'fDÅ-0@H=t'AH5"H=z D$,!HD$HH$L= H$HD$8HD$H$HD$ HT$H<$H$<#t< tH<$ "HD$HD$8H' IH|HA\$(H\$IELILIDIDHLHHuLILLHHD\$(I9H=^s'H=Xs'H=s'D$(x~=s'qs'~ ]s'H=s'H= s'Lt$ LDT$(t$,LEH|$LHr'Hr'Hr'Hr'Hor'2fH11KH|$8DH|$fYf>r'ÅfH 1YK|H 11H.K fATUSHH $H0HudH%(H$(1IAH|$HH)q'HHT$0HH H\$@H8 H=6HL$HH AHHT$hHH\$xHhH$HJH$H H$H=H$HYHD$HH$HH$H{HD$ HD$XH$H$H$H m D$tD$(D$8D$PnD$`D$pƄ$aDŽ$DŽ$Ƅ$sDŽ$DŽ$Ƅ$wH$(HWH$H$8H$pH$HBH$H H$ H H$H: H$HH=H$XH H$`HJH$HH$HbH$H=H$HYH$HCH$H$H YDŽ$DŽ$Ƅ$0fDŽ$@DŽ$PƄ$hqDŽ$xDŽ$Ƅ$IDŽ$DŽ$Ƅ$iDŽ$DŽ$H$H*H$H{H$(H H$8H H$@HWH$`H= H$pH|H$xHJH$H H$H=aH$HYH$HVH$H{H$H$PH$H$H$H H$Ƅ$WDŽ$ DŽ$0Ƅ$HPDŽ$XDŽ$hƄ$QDŽ$DŽ$Ƅ$kDŽ$DŽ$Ƅ$cDŽ$H$HF H$ HWH$0H$hH$HBH$HPH$HH$HBH$HE H$HH$HB H$ Hk H$0HH$H OH$@H= H$PHBH$8HB$H$XHL$H$xH$DH$DŽ$Ƅ$(lDŽ$8DŽ$HƄ$`fDŽ$pDŽ$Ƅ$TDŽ$DŽ$Ƅ$DƄ$dƄ$@gH$XH H$hHH$pHB(H$H% H$HH$HH$HB4LH$HEH$HƄ$xGƄ$oDŽ$DŽ$HMk'k'1ÅTH-k'8|H=GH€MHƹAH=Ot>H$(dH34%(H0[]A\fDAH=j'H=j'H$ 1ҾHIÅuH=i'HEARH|$1HD$H_'"HHL$1H5HH1gI1HN CHHH|$!@H=)i'E1,ÅD1@He11{BqH51{VAWIAAVHHAUATUSHvh'HdH%(H$1H|$HHH\$`HL$@DHFHT$pLHHD$@H HD$PH$Hh'H$HH\$xD$HnD$XD$hƄ$dDŽ$DŽ$H$.ÅL-g'MHD$(LH=H X'Ht$(HH=kD${\D$1L$L4HD$0HD$HD$8HD$@HD$(L1ҾL (1HD$0HH HD$8MyMfWHGH|$H|$1MH Huzx_H|$011ADžeLHx*H5LLLƄWDH|$8HH|$0L91@HD$(H<(H L9uH|$( L$1He'H5H=:f'HuMiH$dH3%(H[]A\A]A^A_DH=e'HÅx &ÅtH e'11H>zH|$8D$DC 8<HL$01HI1>f.L-d'\$LH;11m>HU11K> DAWHfAVHHAUATUSHhdH %(HL$X1HL$ )D$)D$ )D$0)D$@HD$P*t4HL$XdH3 %(Hh[]A\A]A^A_fLt$E1111LJ'ÅT$E1E1H-!L|$MAG~g1Yu>HA9_~KHixIGHp HtH€tH8kyLD$ 2D$ fAI0D9l$v11H1<8 AU1IATI1UHSHxHHULlj` 1 LH@* Ht H[]A\A]fD 8H='LHI1GH[]A\A]f.#t8 t3t1Cu*Ff9GfF9@1ff.fAWE1E1E1AVE1AUATAH=OUSHHdH%(H$1HD$uHD$XHHD$8fDD$yD${D$|fD$Ƅ$DŽ$fD$Ƅ$DŽ$fD$Ƅ$HDŽ$DŽ$Ƅ$HD$@H\$PHD$`HD$hHH5HHHHEN1LNH='EN1L$NH=k'fEN1L-NH='?EN1L.NH=]'EN1L/NH=֌'H$H=='HHD$H=č'H$HHD$H=A' HD$uHHD$ H=' HD$|HHD$( H=A' H$HH$k@tNH^H|$8H$dH3%(' H=Hĸ[]A\A]A^A_. fDHl$8 HL$@HD$8HL$HLt$HL$@Ht$Hٺ H IHLd$8A<$#Ht$ 1LOH# C clasI9$uA|$suHD$HE1E1Hٺ LH] HsLD$8ADEu3H4$Lt9 AH'f.Eu+A@f9$uLE Hr'uD$fA9@}EUDH# C clasI9$A|$sHt$ 1LA fCDH|$8E1} HD$HH'DHٺ LHEHLd$8A$#tԀ ADEH L HD$LHPHD$(LH1A<$ ^_t A|$ pIL$I9bAD$ A8GRL H3'Ld$8D$~A9D$)LA H 'Hl$PHL-HH}HL_ HtHNfHH='LT$8HHHH'L z'HH z'DMH1@0@ H f.H م'H=C H|$8%H$dH3%(LH=> @LX H'\@0@ ,LqLA@u Et.A0A wf0@ LrLB@u7@t30H@ w)0@ HpHx@uA1@t00@ w"0< mIAAIquAHL1QHRWLH H=ӆ'fDMt+0 w0 HPHHuAt,0 wx0 IAQIIuAt$(LWP5DHUnknown ABdeviIcefAB ABWH='H'@H='Hޅ')H=…'H'H='H'H='H'HD$8Hd'H$dH3%(Hĸ[]A\A]A^A_L 9'MAt+0< wI$0< AIAAIQuAt$(L1t$(L׾1H%ZH='YHhH1@t,0@ w0@ LqLA@u Et6A0A wf.0@ LrLB@u7@t30LO@ w*0@ hHpHx@uAQLRs8lH=u'HH1HxsH*IH Et,A0A wf0 HJHrut,0 wk@0 HHHpuA t(0 wM0 vWIAIIquARLPIIHIH`H 9HILHH[Et+A0A wD0 vdHJHrut,0LO w$0 v&HHHpuAHL6RLHHHIHGsIH cHGHoHIHP?f.DHG HL@HHtH51fDLH51f.AWH51AVAUATUHSHLo IMIULHt jI}11 SH}t! BH}11u +H=LeM4$MLE1H89BAGIIHuE1L=fDMFIL1HEAT$IL4MuLڿ1H 3H5PH 1LH5- SHMIUHH5 1H}tH[]A\A]A^A_fIE0HX(HtH=\H-LCH H1H[(HuIUHH5U1[]A\A]A^A_wH51]YfDAWAVAUATUHSH8dH%(H$(1HB L AIL&H\$ LMtHH gH1ATY^H!A<$-uf.IA<$-tH=LÀۅCH= 2LÀۅ9HE1L8H$MtzI7LtIwHtOLouCHLLDAWH$(dH3 %(H8[]A\A]A^A_fDH $CHLM>A?-IGu IHx-tHLDcHHH5C1gHZL1H5X:L1H5E8f.@1t$x$tCtÐSHD[fwH8f`wffffpffD@t#ffmH8ÍfHH8 fAUATU1SH(dH%(HD$1.thH_H5HHtPLl$Ld$H1HL$ MLH57t 1LLHH51@HT$dH3%(u H([]A\A]U1SHdH%(HD$1.t:H_H5 HHt"1HL$HHH5O1@Ht$dH34%(uH[]VfDAUATU1SH(dH%(HD$1.thH_H5HWHtPLl$Ld$ H1HL$MLH5t 1LLHH51@HT$dH3%(u H([]A\A]USHdH%(HD$1.t`H_H5HHtHH1HL$HHH5lt'1HH5HS 1HT$dH3%(uH[]fU1SHdH%(HD$1.t7H_H5/H Ht1HT$H5 1H@HL$dH3 %(uH[]fATUSH dH%(HD$1.t_H_H5HHtGLd$Hl$ 1HLD$LHH5@t1LHHH5$t1HT$dH3%(uH []A\@'9D$ fUHSHh~'1HiHpHH8N9hH}=H}4H} +H}"H}(H}XH}`H}0HpH[]ff.USHHW~!1fDHixH{H49kC ~$1fDHiHC(HH89k H;|H{sH{jH{(H[][ff.ATH+UHSHLEdH%(HD$1HGHHH1ÅxPH<$11 AĉÅx1uuY>ÅxEHM1DJD&H<$HT$dH3%(u H[]A\ff.fHH!ʁ t€DHHHD@HH)…~IH|/t4H 9/t!BH@HЅ~%HPH |/uHDÐHcu1ÐAUATUSHH $HxH*L&IL$dH%(H$h1IHH|$ÅHEH|$Hx 11H|$}xvHl$HHADEuUHU HD$(I3$I3$H u2HE(HU0I3$I3$H uI$H9E8H$hdH3%(?Hx[]A\A]@Hx;H$`fHH)$L$P)$ )$0)$@9HLIH W1CHL#HLƄ`H!%t¾IDHWHDHH H1HT$LxrD$( LL~PHƄPLHHt6HH u(HH$C$C $$uFH|$@HID$lHMHT$H3HI3T$lH @9EHEHwHx 1x+H}1H$H*HpfDL fDAWAVAUATUSHHXH 5'H<$HHt$Ht$0HT$H dH%(HD$H1Hc0>HL$HH $)HL$8E1E1HL$ HL$@EHL$("fH$ID9(_HD$HKlmxDl$HHEHHEHD$0JIvVtAċD$Xt*Hc1HDHHD$0H<HCH9uH|$0 HL$HdH3 %(DHX[]A\A]A^A_fDH1 HHD$8H<(HEH9uH|$8E1IH$D9(E\$D@Eht&HT$8HH<`hBhuH|$8C>fDs8HiHL$H=hj'IHȢ1D#E12fATI@@ULSHPdH%(H$H1IL11LHHtQHƉHڅxo H!%tDHJHDщ@Hz tlHH$HdH3%(HP[]A\38,H=5i'LHI1H1Bf.1ۋ8H=h'LHKI1rXUHIH}S1HdH%(HD$1H*5#H<$HH11*ŅHމHH H!%tDHJHDщ@HH)HD8 1HH9<3,u3 Hڋ H!%tDHJHDщ@HH)8xH=g'H $HbI1pHH<$1H|$dH3<%(HueH[]9H<$fDHڋ H!%tDHJHDщ@HH)AWAVIAUATUSHH|$PH=6Ht$XH$T$HL$@H -'LD$xdH%(H$1LA Hc0HT$PHBQ H$H$HD$D$DHL$hHT$0fDHcT$DHL$HRL$dHL<H$H'H=Y'Hپ1HnH1ff.fUH5ySH(dH%(HD$1HL$ HT$HD$DD$ L$1H|$HW xaH|$HtWH5SH|$HHt9H 1RHH\$dH3%(uH([]ff.ATUSHdH%(H$1IHIIH SHúL1,1L1`ŅxjE1AHc1kIHH_H$dH3%(LH[]A\fIH L11L1ŅbE18H=V'HHI1]HeaE1YH=V'H1E1H 0H tV'H=IfAWAVAUATUSHH $HHH|$dH %(H$81H=.HIHD$0H$0H$HD$,L-HD$f.LhHx.tHXMH 1IٺH$1H1XAƅxH4$ǺDIvExHT$H<$1H5Zq|$,fIMH oH11H1Å/H4$?HD$HT$D$GH "HPD$NPD$UPD$\PD$cPD$jPD$qPD$xPD$~P$P$P$P$P$PH$1D$D$HpLPHD$8t'1H$8dH3 %(uHH[]A\A]A^A_øfDUA H SHdH%(H$1H$D$ HH`DH$H$HD$ H$H`Ƅ$bH$kÅH1ɺE1Hl$AhU.ZYÅD$ 3H=|WH=KHT$H51sHT$H51[HT$ H51CHT$(H51+HT$0H51HT$`H51HT$hH51HT$pH51H$dH3%(uRH[]f~H=Q'AHH1@hHc11DH5lHHD$(dH3%(uH8[]A\A]A^A_ЩAVAֺ AUAATAH5.USHcىH dH%(HD$1H01234567HD$89fD$1A@Bw 1AHl$DHK H1H5ЬA@Bw 1ADDHH 1H5z荬 H.'HLH5X1iHD$dH3%(u H []A\A]A^觨AVAֺ AUAATAH5USHcىH dH%(HD$1H01234567HD$89fD$1A@Bw 1AHl$DH H1H5蠫A@Bw 1ADDHhH 1H5J] H-'LH501:HD$dH3%(u H []A\A]A^x9scAWAAVL5-'AUAATUSH@t AE$?tE$?D|HDA9wH[]A\A]A^A_Ðff.@AWAAVAUATUSH]H8dH%(H$(1H|$HHT$HD$D$HHH HT$`HD$@HD$H=PXHL$pH HH$HD$H|$xDH$HL$@H$HکD$HwƄ$bH$Ƅ$jH$)Ņ|$AĉAHV+'HE1P1ɾ_AXŅ7f=&+'D$1҅H+'AHP1E1DKZYŅD$Cl$\$HqH/H5HD1̨ *'1*'H5諨L P1LH HH5w;*'faf=f *'*'H591,@D蠥H$(dH34%(%H8[]A\A]A^A_D~H=O%'AHgH1֨@)'Dt$f*f=f !*'*'H51u 蛢>fDfE1)D$ AHE1)D$8HD$11PDH\$0Sj H Ņt$tM1L-)'@ATHH uNH=d)'1HH('Hs fHHJH9uHH('ALPUf舶H=#'AHH1h+1ɺ *1ɺ1ɺ{ |  fDf=''u~ۻL-''MufDAA|ٺHpHuދ=''H''H5ٱ1= ''''H51f.f=&'wE1E14fDDDAAEAXDD_Af.kIcDLHHbE1H߹ E1H߹E1H߹{HA |HA A Hߺ}L1LAfDf=z%'}IHD$pDLHHoEH%'L-x%'E1H$MuDCCTDHAHH$F IIuыO%'AH߾D x%'WLt$H5HH1L!H1H D%'H5L1L8D 3%'*%'H5{1臢 ff=J$'wQE1HHD$ADHL5$'HH$3EDHAAA]-G H<$ADDIlEIwA]EvDL5#'M~DAA<ٺHpEHuߋ=#'(HT$:tdH1L$,PDL$0DD$,L$('^_H$dH34%(uwHH 'H=u#H 'H=H q'H=ۗvE謈7H 'H=\AH==dADD1AH=1'HňH 'H=A}D$ fDHt$0)D$0)D$P)D$`)D$@HD$pD$0D$XD$`Ač)H 'AE1H=N@EH=^'EHH1+ff.UfH8SHXdH%(HD$H1HL$)D$)D$ )D$0HD$@Åx[HE1E1HD$1ɺ1PjjH ÅxMtcKH='AHH1+HT$HdH3%(uXHX[]H=>\f.l$ 1EH IAH51谅 fHcHvHtHDf2PfQ@A@AWAVIAUATU S˹ HLL$L$Ld$AHLdH%(H$1APL^_Ll$$H 1t$ALLo ZYHcH\$0HAALN@Hߺ@P1AUATH LHߺ0k$u@HD$xdH3%(uHHĈ[]A\A]A^A_fDD$$+INFLl$$D$(eHH51sAWAVAUATUSHH $HdH%(H$1HH=H5~$fHL$0HuHIHD$)D$0)D$@)D$PHD$` D$ LH=ISH=L^H=C.H=~L_H=ޠ H=2~L^H=H=M~HE1H$A1ɺU_AXHD$(HD$fD$HD$(!LmLH\$p@,H1Lhz,h}AU IEHپI RAURHޠPH PAEPAEPEM1EEH|$@AUH(IEAMEMH5RAURHPH PAEPEE1́H0M9Au u A}EuEMfE!AH|$HS㥛 I MLHHHIHT$(Mi,HߋPL˟M)DlAVQHQHQH Q@,P1(|H0H1ɺE1U|$AZY3H=:&AHRH1\$ H|$|H$dH34%(D$ uLHĸ[]A\A]A^A_f.$$$D$ |ff.HHdH%(HD$1LD$Ls{D$H=HI€t9H=ЪL€tH=LHL$dH3 %(uH{AWAVAUATUSHH $HHCH-L%dH%(H$1AH|$(D$D$Ld$ HHT$PHL$ DHa/HϝH\$XHD$0HD$HD$@HD$HD$xH24D$(nD$8 D$HD$`bH$+ÅxfHAE1H$1ɺUt$(^_AƅtdE+ADoH=&EHH1OH$dH3%(H[]A\A]A^A_@L$D$H$L-'D$ vAƅg  $H$LʨP$HP$$P$+P$2P$9P1D$@xH0H8HL$HLxL$ L1H5Ƅ$&}H}jH5H1}H}jH5H1|$H5)1|$H5G1|$H5d1|$1H5}|$0u2.Hr DtHHH 8t$H5r1&|$H51 |$H51{$H51{$H5Ν1{$ 1H5{$D$fD$EJD$|$ $$D$fD$EVD$|${ $0D$fD$EbD$|$ $<D$fD$EnD$|$ $HD$fD$EzD$|$d $TD$fD$D$|$ $`D$fD$D$|$ $lD$fD$D$|$# $xD$fD$D$|$$D$fD$D$|$MH=LxIxLHHHH_gA $HwIH51myHL HH"gA $HwIH5W10yHLH}CA $LKHwI1wDL$ MLHH4H5 1wLs1H кHa+H5w1HLHHieAHuIH51xwHLHH-eAHuIH51cHI3cHAL )ATI1HtH5הL%o.uHL H{XHZbAHuIH581tHL H=HbAHruIH51tHL HHibALkHsIH5d1qtHL HH&bAL(HosIH5!1.tHL H{HaAHIH5:1sHLH?HaAHޟIH51sHLHCALHH5>PAUCP1ATD lsH HLHCALHH5PAUCP1ATD sH HLHgCAL[HGH5PAUCP1ATD rH HLHH`AH IH5؝1rHLHHE`AHIH51TrHLHH `AHIH5`1rHLHeH_AHIH5$1qLlHlHƒfHH H*XeT$H5gHD$D$fD$HT$1]qv$}H5HD$D$fD$HT$1 q $qH5}HD$D$fD$HT$1p$eH5HD$D$fD$HT$1p5$YH5HD$D$fD$HT$1ip$MH5HD$D$fD$HT$1,p_$BH51 p$5H5JHD$D$EifD$HT$1o$'H5O1o$)H5d1o$+H5y1}o$-H51bo$H51BokAUATUSHXHT$0HL$8LD$@LL$HdH%(HD$1H$$HD$HD$ HD$HAL->fуHL$$HHtH߾,HHHhHaH7HHH͒HHHHqHLH)HHȒHS㥛 AVAUATIUHSHdH%(H$1HLt$Ll$PHHH|$LH?HHH)H\$Hi`LPLHPcM1MI)H KHHeH$dH3 %(uHİ1[]A\A]A^_ff.fH(oG dH%(HD$1HG)$HD$H}HIH΋H!%tDHVHDHY@LHH)HH5HF11HD$dH3%(ulH(DHHʋ2H!%tDHrHDH5,@ǿHH)HH`YHG1@b^fAWAVAUI ATUSH(H|$dH%(H$1`HH=u&Hl$HȄH HII1c1H1aAƅ` HDP_Hڅ= H!%tDHJHDщ@Hz fL{1L_MHAEH u1c1H1EaAƅj HD^Hڅ H!%tDHJHDщ@Hz 1L1_Ht$D^L[H[H$dH3%(JH([]A\A]A^A_DMH H1"b1H1V`AƅkH=t&H !H1``BB'H !HH=&1` DMH H1ra1H1_AƅaH T!HH A!HjH=&H *!H1"`h[AWAVAUATUSHH $HdH%(H$1AH=ƪH~ZHG&H5~1Hl$^HD$D$ HME1H5YHk g^1H5~L-J^CH510^CH51^CH5T1]CH5ӪT1]CH5T1]C H5T1]S 1H5]S 1H5)kdy]H5C1_]H5Y1E]H5o1+]H=XDMDEDLM1AH\AuHE1L-SMDMDLDE1AH\AuHIE1L$DH5R1E1\K|`HtLDL1H5e^\IIuɿ AIrWAuLE1L=;EL$ED$DLA $1AI\AuHÐE1L-< DKDLDC1AH[AuE1L$DH5B11ۿ[H0HtnLVL1H5wp[HHuʿ AHVAuH$dH3 %(D$ ugHĨ[]A\A]A^A_DH51 [H51ZL$ H=U&HΩ1[+Wff.ATUSHӾA1ZAąy(fHDVxLHw׉HDjVDzZxIDW1[]A\U8[H?HH=&1[[]A\XU8Q[H?HH N&%H=ZU8[HHU8ZHHtff.@@H'HcH>110bFD111bFD000bFD001bFD010bFD011bFD100bFD101bFDHINVALIDHfAWAVAUATUSHH $HHH4$AADD$dH%(H$81;*HE1E11HD$,1PjjH Åml$$6D$DHNVHIHD$NWIMMH<$A14XD$ 0L$Ht$E1AD蜱ŅHt$|$ S=|$D$Ht$0DŅTTXH|$(Hc]XE!H &H=XnR |$HD$@ HH$H<$Aw3j|$ HLRA9IL;<$uH $HL)H9s AE)DL$MI1LD>ŅyH=#V/D$fDQ8WH=&EH &IH1WH|$QLQDfSH$8dH3%(|HH[]A\A]A^A_Q8 WL$H=&H IH`1Vl$ {HD$@  HH$~fDDD$H=&1H SH=VD|$ Rf.H=y&A1H HUf.H=DUhH=)&1H HUrf.HD$@  HH$fDH= T7؉hH=&1H IHʦ=UgH=&A1H H̦ UDL|$(P1LQPHE1E1HT$,1ɾRDAWP0H Ņl$5@ALHD$@ H$}NxAȾ1H=&H KH?T<fL:NDH=y&H H1SbH=A&AHH1SH=SH &BH=exSMLMCH &>H=sNff.LPOHx{fH*HfH*^ Yf/sH,HxfH*f\H,H?HyHƒfHH H*XHfHH H*XHuHfHH H*X`SHH $HdH%(H$1HHHH¦u"$H$dH3%(u,H[H=u&1HRDM@USHdH%(HD$1H\$H$HD$yxEL$X Ёt8Ht$dH34%(uFH[]Hމ1yfDD$H=&Hf1:QLSHH $HdH%(H$1HHHHruuHT$8oD$oL$(H)H8)KHS uF& HHV| tH3H$dH3<%(u9H[fD(H=&1HR]PKSHPdH%(H\$H1ۅME fH)D$0E)$A)D$ )D$HD$@$D$DT$(D$4T$8L$HD$\Lt$eAD$ HD$L|$S[@H51%3A G.fADCD$ D$ 9D$AHcHD fD$(HHD$IHAFL,@IE&IHD$\AHH|..HIE.HD$eT$(1H5Ubt2|$|$0[H58b1H2HH50bHHH#T12H5a1 2HH5a1HHU1H5a11HT$H5=B11H5a11L1H5 B1H5ua11U61H5rap1H5Ma1]1}7LL1H5A;1H5a1(1U8fH5a11H5`10HD$xHHLl$pHq`/'{^HH#LHIe}XJHD$xIILHHHIHHHHIII)IIE)IHILHHHH 'fT$ fT$(;fAUATUSHXdH%(HD$H1H Ht%1H|$HdH3<%( HX[]A\A]@\HKH5IHH1L]H HH513]HK1H5e[H]HK1H5h[H\HK 1H5k[HL!\K&1H5HH\HK(1H5O[HL!L\K.1H52H\HK01H5.[Hp\HK81H5&HV\HK@1H5 [H<\KHHH5[1#\KLHH5 [1 \KP1H5 [H[H5[HHH#KQ1[KXHH5Z1[K\HH5Z1[K`1H5pH[Ka1H5ZHf[HKh1H5ZHL[KpHH5Z13[Kx1H5ZH[H1H5ZZH1HH5ZZH1HH5ZZH1HH5ZZfLH'T$fHT$ D$ H9u|$D$ fD$l$|$l$HL$H1\$ H5DZZHD$ HT$ D$ I9u|$D$ fD$l$|$l$HL$HLl$ 1H5YYH1H5YIYf(1LLLH Y)D$ )D$0HD$@'11LH5YH)YfA1H] HX`DH=ULH[!HSH 1H5ۄ%HKHS1H5f%HS 1H5H!L%S&1H5"5%HS(1H5;H!%S.1H5I%HS01H5]U$HS81H5K$HS@1H5\$SH1H5f$SL1H5x$SP1H5|$H5T1HH#SQ[$SX1H5zE$S\1H5/$S`1H5$Sa1H5$HSh1H5Dž#Sp1H5zT#Sx1H5T#H5T1#HH5T1#HH5{1o#HH51U#fLHL$fHT$ D$ H9u\$ H1<$H5T"^_HD$ HT$ D$ I9uHH51<$"XYH5S1"H5S1"H1HH5Sb"f( ~1|$D$ fD$l$|$l$HL$H?|$D$ fD$l$|$l$HL$H?hfKbH1H5}UUKcH1H5xUTKeH1H5rUTKgH1H5lUTH1H5cUTH1HH5ZU~T[fSbH51!Sc1H5!Se1H5Ѓ Sg1H5 H5-R1 HH51 CH &.H=n!ff.@ATUSH)Ht 1[]A\@RHKH5UTHH1VSH HH5LT1=SHKH1H5FT#SHKH1H5?T SLc H1H5ARLHHH5T1RHK(H1H5TRHK0H1H5TRK8HH5P1RKhH=&1HA @sMcD$,LD$HHf1Ht$0HDŽ$)D$PHD$XH )D$`HD$dD$)D$@)D$pD$@ɉD$p|$8ANHDŽ$D$D$lHD$@HH$^AƃJ$ID|$E1Dd$H$ANHfD$@D$Hl$XD$dD$HD$xD$hD$DŽ$D$lD$D$pDD$t]AƅD$HL$HEADExHH*#H=A&EH WIH1@AuEf.H=&E1H H|f.H5sILHD$H l$,Ld$ +DA5#H=&EH IHg1t$XA1AUH H~DL$tH=D&ZYH H )&E1H=I<"H=&EH IH~1ytDD$H=ȏ&1H HH~N A8LD$ H=&H IH'H1TO 8HH IH=G&H'H1A 8H 8IAWAAVAUEATAUSHxH4$dH%(HD$h1HHhtLH4$EDDpAHU DH\$hdH3%(Hx[]A\A]A^A_fHt$ DHD$`)D$0HD$8H)D$ )D$@Ht$)D$PD$ HD$DZAŅYEȉD$ |$HD$HHEHL$fHD$`)D$ Dt$AHD$ )D$0)D$@)D$PE9DHt$DEGHD$HD$8DD|$DD$HDD$TYEE)u1H=U&E1H IH^?1H\$H<$T$HHA L$H= &H}1EfH &.H=|S!fDH &)H=|+ABH=&EH>H1"AWDD$DDT$H=T&H IHSc1Et$8A1AUH HVzDL$TH= &XDZDT$H=&H IH|1EoH=ȋ&1H|H sNH$ H!%tDHJHDщH-PARTIALHHB+K A8>H=G&H IHD1x A8H=&H IHC1 SfHHH`dH%(HD$X1H)D$0HL$Pt$0H)$)D$)D$ HD$PHD$@$HL$HT$$VuD$P1H\$XdH3%(u`H`[ÐH I&)H=zD$P AH=&HH'<1 fAWAVAUATUSHH $HH $HE1dH%(H$ 1AL$HH$IֺHHLLHHHHHDaAąHEHUf.HH9t8 t|$tsHHMAVL&BH1UHRH HH=H$ dH3%(DH []A\A]A^A_@HuH H!%tDHJHDщ@H)JH=f&1H]A fKH :&H=xA > fAWAVAUATUSHH $HdH%(H$x1Hl$pAHHHt HH@HDHT$ DÃD|$EuNH g& H=y H$xdH3 %(7HĈ[]A\A]A^A_fDD$ ELIHDfHt$ D)D$@)D$ )D$0)D$PL$H $\$PHt$HD$`D$ HD$8D|$DS $GK<&L$HH|$81L$TD|$DH=s&E1H IH|81 HDLLHt$fɋD$DHF@))N)N )N0D$ D$PnRÅ,H=&AH7H1l vH>HDHT$ DÃ+D|$EH s& H=vH=A&AH IH=\1t$8E11jHOsH DL$TH=&LXZD$ fDH &&H=v++H &H=u.H x&'H=u H V&'H=u&8H=#&H IH<1ff.USHXdH %(HL$H1ɅfHH)$)D$0)D$)D$ HD$@$D$D$8PÅu$D$DEHT$HdH3%(uFHX[]@H=Y&AHWuH1fDATUSHH $HdH%(H$1HHHHHHHZAąHCHS@HH9t8 tHC?HSDHH9t8 tH;LKHPHCLAHP1XZH$dH34%(Du0H[]A\H=)&1HWAUSHH $H(dH%(H$1Hl$H|$HH1H|$IL AH :H:+x_H|$A1<xqH|$gH|$H$dH34%(u:H([]@H=&1H HHsUSHHHt1H[]+5KLH5:HH1n6KPH1H5:T6KTH1H5::6KXH1H5: 6K`H1H5%6KdH1H5@5Kl1HH5V:51H: HV5H=Ir$SL1H5$9MSP1H5)96ST1H5$9SX1H5 9S`1H5'9Sd1H5+9Sl1H5-9H1[]H #&.H=`4USHH9<HHDOLZA ;DBz E9EG=wT9uLE)uH[]BHLA vEA{EAE9ADuJG=vHHNr11WH=2~&HXZH[]fD1HHQq1WH=}&Y^WH=}&1AHp1\+H }&@1H=&p1DAWAVAUIATUSH8t$H|$Ht$dH%(HD$(1H螝D$=PEAH>EPE11hE1ɾjIjAVjsWH0HqAE<$Av%LfA<$IUIHATE1E11AWھjjAVjWH0uwHD$ t$A<$LM|$HHD$L|$ t$CAƄHD$ HIELHL$(dH3 %(DH8[]A\A]A^A_DAHpH={&1E1v@E18H={&H-H1D|A$ATE1E11ɉھPjjjjVL|$PH0t$HL$A<$LUAƄDD$H=>{&1Hcpff.@ATAUSHdH%(HD$1HH$^ńtPH$HtotD:`tH H8XtH9u1HL$dH3 %(uWH[]A\DH=z&Hp1 H Yz&"1H=o*f.ATUSH dH%(HD$1H\$H|$D$HD$TD$T$XugH1ۃ#HHHEؾgHHHEcuQ=PH= Pt7H=Pt =PHED1HL$dH3 %(HyH []A\D=&=$=$="r="<HHHfD=PH`HEafDH=PFH= 1H=PHEf=%=&=$<MIIc<HHӾHc LELHLEtLHLEHT$HD$==u-LHˀ@!LH=#<HHH<MIAf='viH=7v1=47H"- '1ۃl<HHHc_@='s-'1ۃvCHމVB"fHt$ 12D$ ==XtT1=H E1IIEܾHHHE<HHHË\<MKIIc L LE%LHLE LHLEHT$~AH atTHD$==u-LHˀ@LHAH 9H=t&HkjHp`AWA H{jAVAUATUSHHdH%(H$81HH|$HHD$1HHL$@DD$HoH5D$XHD$@H/HD$PHD$HD$`HH.D$hHD$pÅ5 qLd$[SL˞AŅ1HHVP1E1E1hߺjjjjMH=-LAH0IE1fH ڷ.H r&H=ibH(H r&$DH=5i0H=r&پ1H9k4H$8dH3%(HH[]A\A]A^A_f8HHuE A HL=9IE1HD$(H,H$L|$ HD$0k&MH5n,IH1'ELH5], 1Hc'ELH5Q, 1Hcn'ELH5O,L1HcM'ELH5A,L1Hc,'ELH53,L1Hc 'E LH5%,L1Hc&M 1H5,L&M 1H5FhLHkd&L1H5+&L1H5+x&L1H5+[&Hl$L<$L $E1EH gH1CL HL1I&INL 붐H趓H1H p&1DH=]hpH3AwH=o&EH!H1WfH o&/H=pfHbL% H ~o&Lk H=qf D HH=Jo&1LL9uH /o&!H=NfHLL%@ H=n&L1HL9uH5n& Hp AIA$IE1E1L EH ,fH1HLC~1I)$It NL @AIAuIE1E1L ?EH eH1KL>`HL1I#It NL< @AIAuIE1E1L EH eH14HLC1IV#ItNL fAIAuIE1E1L gEH `eH1HLC~1I"ItNL AIAuH,$L|$E1L5e1L ELH1LHLI/01Hn"HtLL, 뻐AIAu1LH,$1' (L!H1H :l&H=vb 8H=l&H1H1<AUA H@'ATE1USHdH%(H$1H"H|$hHD$LHHL$`DD$hoHD$xHD$`HHD$pHD$H$H%DŽ$H$JŅH|$VAŅHt$ HHHxHHHǀHLH)Hu[1H j&H=`!t$HH$dH3%(>H[]A\A]DfHt$HD$P)D$)D$ )D$0)D$@D$H\$(D$46ŅE&AkwH H5fIH1HKL1H5{%HKL1H5{%HKL1H5fmHK L1H5fSHK(L1H5J%9HK0L1H5fHK8L1H5fHK@L1H5%HKHL1H5fHKPL1H5fHKXL1H5fHK`L1H5fHKhL1H5$iHKpL1H5$OHKx1LH5$51L" L@H 9h&$DH=^H=h&1H aVH=x#4H1H5a^HS1H5H=GP&HH1+@E1H=P&H H!Y+1H$"foٔHLl$`H$2HLL$"HL)$2HDŽ$2liHDŽ$2d%H$2LHHL$HL$1H|$ML pHLD$H=O&1H H H|$LvH|$lH N&*H=xW;HϾHL$OA8zAH=}N&H FIHTW1FH=ON&H ؑH@1UAH~SHWHdH%(H$1H|$D$ HD$HHHT$HH=WHD$HD$HT$HD$0HD$ HL$H\$@HHT$hHWH|$xDH$HWH$D$dD$PeƄ$sH$jÅĀT$L$t$  QHE1E1HD$1ɺ1Pjj 1H Å$H L&5H=IW4@H$dH34%(TH[]DHE1E1P1jjj-H X@H=AL&AH7WH1sHE1E1P1ɺ1jjjP-H ED4H=VZ%H K&H=p 31H K&H=A 1H {K&H=V'H YK&H=V.ff.SfHVHdH%(H$1HL$P)D$P)D$`)D$pHDŽ$Åxlf@@upHE1E1P1jjj+H /H=J&AHH1H$dH3%(ugHĐ[ÐH)$)D$0)D$)D$ HD$@$D$0#1H J&H=G@uff.SA HHdH%(H$1H|$hHD$HHL$`DD$hsHD$x HD$`Hl|HD$pHD$H$HUDŽ$H$XÅx_zuo1H I&H=Z?H=H&AHH1H$dH3%(u}H[DHD$fHt$)D$@)D$)D$ )D$0HD$PD$D$@D$DhHT$H5G11I1H$.AHDŽ$HHH$ HHDH$H$HH$H$H$HƄ$dDŽ$DŽ$H$`ADž H zH$HD$0HtHHH\$01H$&f H|$H$PH H$'HH|$8HH$( )$H|$hHH$) )$H|$`H@H$,HDŽ$H|$pHH߹)$%HDDŽ$%HDŽ$g%Ƅ$o%\HCHSf.HH9t8 tL$%HK1H$g%LH5HK@ 1HHLIH=E&HQ1KH$^xH$*1HH|$( IHH$LP$P$PD$1D$$vH LH$p%L$^%IHD$H1v LKwH L1Ƅ$f%HDŽ$^%Uv LwHM1AUH|$HMH Hv_AXH|$0 LL$8HL$0LH|$1HuH|$wiHL$1E1H=8D&H$PHQHLHHD+H$%L SHD$HI1t$ LHBt$ HL$BuY^LHwHLH1HپD H=C&1HP  @DHH  H=;C&1HPHH$P1@HHHھD aH=B&1HPuH$P1@HHHDH=B&1HP1H&+Ls(@IŋsI HSE1PDE1ɾH_AXKA1H="B&H;PHH赿I9uLL-&H$Z%虿MH$Lt$.AMH=A&H&P1RITM9AUtHE1E1U1ɾDSj%H AuAEt$ Lt$ L LAUHITPHL$(1rH HLuM9mDŽ$DŽ$E H$DHHD$(Ņd$t$`1ɺ1L$IDHsŅ $D`At8Ct$E1f.ЍJ fA9uDDŽ$H4@HHT$(DHD$PH$D$DŽ$ÅS$LL$(11IDIsÅ E3 AEX 1D|$@A @AV,A9]E9TD-ADftDL L4R1ooPILt$PfAV.HP L@(AVIV AF*fAF(AFAIqfA~ uH5L>sQH5L"s5H5LsҁH=>&A1H =HM H=e>&پ1H%OH$HD$XH|$PLu1L HHDŽ$t$ t$ HL$H|$ zoDŽ$DŽ$DŽ$_AXHt$(DHT$XDǹAƅ$$F$9ӉЉF1AƉT$(AąqAD$HHEAD$H$E1D$1HT$ fAAD9A;D$u D$($LL$ 11LDDptH=<&AAAH -H~N1:EH HNH=<&1HH=g<&D1HNHL$H|$h1L`HmHL$0HHMLTPH.1APLL$HH|$pqmY^H\$pLL$`1H LD$hH9HCmH˺H ;&(E1H=NH$>dH34%(D H>[]A\A]A^A_HC HHD$(mHL Lvt$(Ht$(HD$@PHL$(1H|$0lH DHH|$nt$ L 1Lt$ H;Lt$ HL$L2lAYAZHLnft$ L #1Lt$ HLt$ HL$LkA[]HLGnmft$ L 1Lot$ HLt$ HL$LkA\A]HLmt$ L h1Lt$ HCLt$ HL$L:kXHZLm7H$+H{HLL$8LHfDH=a9&A1H 5|H.HH==9&1HGȼt$ 1t$ HL HL$LBH|$ ujDŽ$DŽ$DŽ$XZH$HD$XH=8&1HyKDH=8&A1H {H~IH=m8&E1H zHJHL$8H|$`1L jLqHUi)DLD|$@$詵H$1HD$XD|$DA7H=7&H1AHGOD;$}DH@HH\$PHk"HtH+DŽ$DŽ$IC D$@MHt$X|$Ds~$IHD$HH9=vHD$HADDH\$xE1D$IfDLd$H)M9$LI9s$LLL$(t$@O&|$DHitH\$xLAHH=6&E1UDL$PH yHFDT$PA[]DT$@H=W6&EH1HF޹LAD;$D|$Df.LL$(t$@M1ɋ|$D$=iA…IH|$1 IH>L}AHt$ t$ Hl$ HL$HgHS"AYAZL9v@LHiHS"K4.Hmi*H\$xtfDH|$LCifD$H|$H"iAƅuHòfDEH ~wHWGif薵D$HDt$(Aؾ1AH=4&H 2wHEF-H=4&A1H mwHC3LfDH=Q4&H vHE1Aѷ@H=!4&A1H vHC褷ML裱fDH=3&H}B1Act$ 1t$ L LzHL$H H|$ eY^fDŽ$LH$HD$XAH=I3&1HAζ2H "3&H=>葶yH=3&1H@A芶RLD$H=2&1Hf?A^&1H 2&H=(AH 2&3H=>AVfDSfHEHdH%(H$1HL$P)D$P)D$`)D$pHDŽ$!Åcf@usHE1E1P1jjjH BH=1&AHH1"H$dH3%(HĐ[ÉH)$)D$)D$ )D$0HD$@$fH)$)D$0)D$)D$ HD$@$D$0"nMd1H 0&H='D=誯f.AVA HAUATUSHdH%(H$1HH|$(HD$1HHL$ DD$(oHwtD$8HD$ HqtHD$0HD$HD$@HD$HHD$P%ŅԵ#Ld$藰HH*HAE1P1ɺz AZA[ŅLZAąDIEA7AH\qH5L1ٱLHfH$dH3%( HĠ[]A\A]A^H=.&H qHKB1H臬H=.&1HK[fH=VLcfLL$ ~ fHɉT$D$HPH9u\$H1<$H5CװZYHCD$HT$D$I9u\$H1H5B<$蒰Lc A]A^H5B1AsL1HH5CYHS(1H5'CBHS01H58C+S81H5ICS@1H5bCSD1H5sCSH1H5CϯHSI1H5C踯HSQ1H5C衯HSY1H5C芯HSa1H5CsLci1H5DAXL1HH5D>Lcq1H5$DA#L1HH56D Sy1H5GDH5\D1خHH5bD1辮H5pD1褮HHD$HT$D$H9u\$H1H5JD<$ZA[1A\H5^D<H5vD1"H5|D1HH5D1HH51ԭLH5vD1A趭L1HH5D蜭HHD$HT$D$H9u\$H1H5jD<$JAY1AZH5nD,H5~D1HH5S1HHD$@HT$D$H9uHH5>D1<$謬_AXH51菬H觧fEA-H )&(H=D@HhH )&$DH= LcfyLT$ DHɉT$D$HPH9u\$HL<$H5,1Y^HCD$HT$D$I9uHL1H5<$K XH5ZL1K$LH51K(LH51lHK,1H5BLRHK41H5L8HK<H5BL1L1 DLcfxL\$ DHɉT$D$HPH9u\$HL<$H51A[A^HCD$fDHT$D$L9u\$HLH51<$WLc AYAZH53BL1A5LLHH51HK(1H5LHK01H5LK81H5ALK@1H5ALKD1H5ALKH1H5sL|HKI1H5ALbHKQ1H5ALHHKY1H5BL.HKa1H5BLLci1H5"BLALLHH51Lcq1H5LALLHH51Ky1H5LL1H5gL1HH5AJL1H5-HHD$fHT$D$H9u\$HLH51<$_1AXH5@LL1H5ZL1H5@}L1HH5`L1HH5$CL1LH5@A"LLHH5@1HHD$HT$D$H9u\$HLH51<$YL^H51L1H5{L1HH5G^HHD$f.HT$D$H9uHL1H5<$ XZH5H=oLcXfLD$ [sHɉT$D$HPH9u\$H1<$H5T6GAXAYHCD$fHT$D$I9uHH5C61<$S ^1_H5N6S$1H5ΤS(1H5E6踤HS,1H5V6衤HS41H5o6芤HS<1H56sfD1H !&H=6蜟8营H=!&HH1#ifAWAVAUATUSHH $HH $HhHlH#TdH%(H$X#1L$PAH$PHD$`LHD$hHD$pHD$xHDŽ$HHDŽ$HH$8HH$H|$hHH$HH\H$H\H XH$Ho=H$HD$`H$H|$lH$0HH$H$H$H$H$H$ H|$pƄ$oDŽ$DŽ$Ƅ$sDŽ$ DŽ$Ƅ$dDŽ$ DŽ$(H$8H=H$HH$HT$xH$H4=H$HOH$H$H$H dH$H?=H$XDH$hHWH$HH$H$H$HH$pƄ$@fDŽ$PDŽ$`Ƅ$xeDŽ$DŽ$Ƅ$tDŽ$DŽ$Ƅ$vH$舨ÅP/ Dl$hER Lt$`M31ALO 0Ht$`LH=&1MH _H{芡|$lvS#H &H=;<AH$X#dH34%( Hh#[]A\A]A^A_fDYDt$lESH$HH=bHɅH=aHɅ^H=`H€_H=FH€@ H=,H€tHƹ H=gDD$lH#uII!H"A(D$ D$$D$(D$,IHHI(NLHHHHHeMAAPAPAPE 1E=MIH LHǾHD$H1MLwIHLL$L1MLbHLLLNAƅ<H=5&L1H9连Ht$ 螂AƅsHt$$ 肂AƅWHt$( fAƅ;Ht$, BJAƅ|$ |$M|$$I<|$(I+|$,H$HD$MOMFH<$;HT$. L^AT$$ L^AT$(H4$ ^AsT$,Ht$߹ n^ÅHLL 1UL`LH IKXZLT$ LMHLLUL 1L`HJY^LT$$LCMHLLUL 1Lf`HJ_AXLT$(H4$MHLLUL5`1L tHIIQJAYAZLT$,Ht$LLH߾LH1JHL$H1L L_HMIIIH HL1ILQÅH=0&1H 7軛fDL$PH|$0JHLL HUHD$PLPD$TPD$XPDL$\1DD$TL$P9IHH ML12HL蕍ŃJH|$``L H!%tDHJHDщ@H.binBD$lL$lDMH$L$D$DLLA[]fDE1DL蠇fDD$l@A'H=&EHH1HD$DE1E1H$LLH<$LܓH|$ғ\DD$lfDH=&M1H"聙u@HE1ɹjD$DE11fD3E11H &H=!H$HD$#ADL$DL$H=Q&HHi1EݘDL$De1H &H=V 脘>H &H=]Ò8跘H=&HNH1J=H=&AHH1+cE1E18SH=\&HH1H$HD$H )&*H=著K8H=&H H1耗ƒH &=H=S26SfH|HdH%(H$1HL$P)D$P)D$`)D$pHDŽ$qÅEfH$1H)$H$)D$H)D$ H1)D$0HD$@$HT$D$@0ufGH/ GHD$$7ÅtQYH=&AHH19H$dH3%(7H[T$D1H5X|$DH= w+D$DHSHcH>fDH=fk|$DO$ffH5 H*$Y9bH*ȸ^^fH=hH=0H=Zt@H=0d@fD1H d&H=Δ4@SfHcHdH%(H$1HL$P)D$P)D$`)D$pHDŽ$ÅB衖fH$H)$)D$)D$ )D$0HD$@$H=ZÅ~!H=0t H=0HHEH5c&H=O&AHgH1֓H$dH3%(uEHĐ[f1H &H=0^ǎSA HHdH%(H$1H|$HD$HHL$DD$oHKD$(HD$HGHD$ HD$HD$0HD$8HD$@QÅx.@tpttHt$ߺÅu%H$dH3%(uoHĐ[H &.H=X/Kff1H &H=|t@SA HHdH%(H$1H|$HD$HHL$DD$oHKJD$(HD$H7FHD$ HD$HD$0H8D$8HD$@Åx.?tp詓ttHt$ߺ賅Åu%H$dH3%(uoHĐ[H &(H=8.ff1H T &H=辐|$@AUATUSHH $HHvdH%(H$1H$AHD$HHH|$h HHL$`DD$hoHHD$xHD$`HDHD$pHD$H$HDŽ$H$脖Å >[$.Ht$Ht H4HH3AăHT$ &|$I蜌IH fHt$HD$P)D$0)D$)D$ )D$@D$HD$(Dl$4Dl$8D$@ -H= &AHH1 t9LH$dH3%(H[]A\A]f.T$LH2H  &1H=M耎H &+DH=Ys迈8賎H= &HH1F@茉ff.AUATUSHH $HHHdH%(H$1H$AH$HD$HH|$HHT$@HL$DH)FH<H\$HHD$HBHD$ HHD$0HHT$XHbHD$hH#D$oD$(D$8D$PsD$` D$pHD$x覓ÅxiH4$Ht HzHHDd$tAŃH<$tquFH ? &11H=t觌H$dH3%(H[]A\A]ÉE11DHyf.H H!%tDHJHDщ@H.binBHH &*DH=6M_ff.@AUA HATUH-`SHdH%(H$1H|$(Hl$HD$HHL$ DD$(oH"LD$8HD$ HLHD$0HD$HD$@H(D$HHD$PБÅH|$2H KH(Aą1\kHt$ H|$A'AċD$=PDED:SHT$豉H|$H=aLD$HLÀۅHD$t:H-@HcӃt$H1HBHD$9wDfDH$dH3%(HĨ[]A\A]fH yJH(H=[&1Df.A1DH=)&H 2JH趉qH=6LH=_LÀۅul?HHD$t/HcӃ|H"HH1kHD$9w1HD ;HfDH=a&1DH `IH&HD$D0Hx{v1H &H=FtOH=&EH HH&h#讃ff.AVAUAATIUSH dH%(HD$1D$D$ )6L/Å?Ht$H|$ $HHH1E1PDALZH=|AYuTEu}DeEHT$DPHD$AAFDD$HuKQA7H=&EHH1Et?H f&H=Z%ІHHT$dH3%(H []A\A]A^DH &$H=胆빐H &31H=$aAH=&H EHNYfN聀8uH=~&HH1Nff.AUA H{$ATUSHdH%(H$1HZH|$HD$1HHL$DD$oHFD$(HD$HFHD$ HD$HD$0H,D$8HD$@NjÅv  HHHPE1E11hjjjjH01H E f8HHuH~Ht$QÅu=H$dH3%(HĘ[]A\A]ÐHt$ÅtH=&پ1H#BHH~Ld$<2L+AŅUHHH1ɉE1PALZH=YMA<vdH=%H3H=!DHl}H %$DH=HE11DEGH}fD?H T%H=H!辂H|sȑH=!%AH9H1訂H!1舂H|1H %H= 9|8艂H=%HH1H=a%H ;|81H=:%HdH1āa }f.SH@HdH%(HD$1HH$bt H$Hu%1HL$dH3 %(uH[|DSfH HdH%(H$1HL$`D$ )D$`)D$p)$HDŽ$VÅ@Ht$  f|$ Ht$)D$)D$@)D$ )D$0HD$PD$D$@?eH=%AH֮H1EH$dH3%(uHĠ[$H t%H=뷺1H P%H=듺'H ,%H=lzff.SfHH`dH%(HD$X1HL$ )D$ D$D$D$)D$0)D$@HD$P貅Åa mHt$THt$;Ht$"Ht$  )Ht$8Ht$GH=#yT$1H5L}L$uAt]@HE1HTD=AHH9t!==uHAH9uE_zHéE1t EAt AKt AltAuaH$dH3%(D$H[]A\A]A^A_DE1A.=#ALd$(%LAAŅQ xCtHH8$H1E1PA&LZH=ϭAY EZ EA Hpf.HL$81E1H=%HvSfDd$ Lt$(~$~LAljD$ AD$<@CsH$H#H1E1t$A@"H=ԬLA^_ E H$Lp1@AVMt9A>7uE:fuI* D$KINH5mHI1莧IN 1H5aLtIVHfH*fIV f.\$zHO!fH*^H,ȺH5L1INL1H5 IvI~1Htu! ]Af/H,ȺH5J%L1踦IN1H5˶L螦IVHfH*f.L$IVz H fH*^H,ȺH5L1EIN$L1H5+IvI~$1Ht  @f/H,ȺH5$L1IN,1H5OLХIN41H5IL趥IV,HfH*f.L$IV4z/H fH*^H,ȺH5L1]INf/H,ȺH5~#L1LINT1H5@L2IN\1H59LIVTH fH*f.L$IV\zHUfH*^H,ȺH5L1迣INd1H5L襣INl1H5L苣IVdH&fH*f.L$IVlzHfH*^H,ȺH5L12INt1H5L1LΧ jL蜢@H<$jf.Lt$(L$AAąq,HT$AoHt$H|$ D$HT$=$=$# 5mHD$HH1E1PALAZH=AA[ EH|$D+NH|$AiEDH=%D1HcocfD=#:H %H==A oD$@Lt$($tjLADžHt$H|$ L$$tyvbP-P!%tWH=%HC1nAH=%D1HA|nm#t rwHT$1mHD$==u- E-lHD$HBP1E1E1hjjjjH=LAH0 EH|$DE1 iH|$g=$t =%, WȀt vVjHD$H[HE11AP7LAXH=ߣAAYOELt$MPE A_ LfH<$fH=%D1HlfD.H %H=$A=lHefH=%D1H$8lRA*{H=%EHH1 l&H ^%$H=kH ?%$H=k+H %$H=k"fiHD$HH1E1PALA^ZH=.AEuH|$DE1?H|$4eAzH=o%EHH1j.H E%H= AjH|$d?.H %H=A|jH|$dH %$H=UPj0H %H=A(j.H %H= jH<$2duKH5 HH1,KHH51K HH51KHH5 1KHH5 1țKHH51诛KHH51薛K HH5| 1}K$HH5n1dK(HH5j 1KK,HH5y 12K0HH5 1K4HH5c1K8HH5 1KDATUSHdH%(H$1.H_H5HCHttH$H1SL &=HLx=HT$ H@ZYu(Ld$Hl$HLHH5#AAt,@1H$dH3 %(u:Hİ[]A\1LD$ LHH5R<H@=@ 1IHt8A<]w.zI@HNHHQ߀]w IHH9uAff.HHtbH=HtJH=xHָt*H=HøAWA H3AVAUATUSHdH%(H$1HAH$HD$x1HHDH$H$HH$HD$xH$HƄ$oDŽ$DŽ$H$hYÅ;LD$xLD$H H ]%Ht$pH1H=:<ÅHcA=HD$H CE1E1L<H$HD$L$f.HL J:LHD$xLuJ HP1:AZ1A[L17?ŅIcމHiAH\$HscH{H551Hq3H 9H013HfHHD$H@@))@)@ )@0$HH$HƄ$H$@H@ LAX9Y;IM9E+1ېHD$pH<H8I9uH|$p18H|$8H$dH3%(H[]A\A]A^A_88>H=%LHtI1D>V>H=%LH@I1>@Q>H=Z%LH8I1=@!>H=*%LH8I1=@1H$pAs Hf?|$H)$foHDŽ$` )$foHDŽ$h)$foH$H)$foyH %s, %s HDŽ$ )$@focHDŽ$HDŽ$p HDŽ$xGDŽ$Ƅ$H$Ƅ$)$PfD$`Ƅ$b|$HH$HD$PHD$8HD$hAFHT$L|$`L$HiAL$pIHAHD$(H$HD$0H$HD$H$`HD$H$HD$ H$pHD$XfDfH*$H|$0l`H LL$ID}1IDAVNI LA.DH0H9HL K.LHD$pLiH(HP1.Z1YL1:3ADžJ.H8?4H=H%LHI13H9uE1HD$hH<(H-H9uH|$h1-H<$-H$xdH3%( HĈ[]A\A]A^A_Ð3H=%LHhI193@y3H=%LH`I1 3@fox|$$HState %sDŽ$, %sH$ )$foQf$H %-12s %)$fo?H$)$fo7DŽ$9s )$fo,)$fo,)$`fo,)$p|$$|H$HD$HHD$8HD$XAEH$H\$PL$0Hi!HIH1HD$(HD$xHD$0H$HD$H$HD$H$HD$AEAL IEHcHHgfH*H|$0D$xImMVD$xH|$H I.2H|$IH|$IEAG fAA)A)GfDDEL1H 8HHI1I9uу|$$At$HKIEP1AAATEAWLD$8HL$0Ht$Xi/H I!L9l$(|$$H\$PL|$XHL$H1H5Lcb1Lgg@HƒfHH H*XfIEEH'gL5LEAHD$@`I1H5%IH1aHL$1LH51aHL$1LH51aHcLH5f1aL1LH51aL1LH5>1ta1L1H H5YZaHL$1LH5r1BaHLH51)aHL$@L1H5aH|$HL1jcPDH %H=.H rL PHpL]PHnH PHdHp$PH5.1?-H HL PHL>PH0LHAQH5P1,H H$`HD$HHD$8HD$X'H 2%H= -+^HD$Xx^HD$HH$HD$8}L1H=۩%HLo-(DHdH%(HD$1HD$PjjjAPE1AQE1jjjjQ1RANHjj*vHpHT$dH3%(uHL(ff.AUA ATUSHdH%(HD$1,HHc,L$$1A1ҾI|$LI$MIDŽ$HH)HAŅE$H H-Au]tED$A Au5t.L&&H\$dH3%(DH[]A\A]@H HH=;%1A+&L%@H= %A1H ]H+L%iN&ff.UfHSHXdH%(HD$H1HL$)D$)D$ )D$0HD$@1ljÅt]~/9H=F%AH IH1*HT$HdH3%(HX[]fHD$ E1E1Pjjj(H ÅtH=Ǧ%1H >HM*PzH=%H H1*O`%U[SHH5%D$ &D$ Y/6H,1=HJ&HFt H5ͥ%H9s H*&HFufH=%H1ZD$ Y*,d)H=}%H[]'\H,H?hff.AWAHCAVAUATUSH8HdH%(H$1H|$HD$8HD$0HHSDD$HoHD$@H?H zHD$PHD$0HD$`HD$8HL$pHL$@H$HuD$XD$hH\$xƄ$pH$.|$8AuqH="HD$0D\$8HD$9AƅtRE9E1H$dH34%(DH[]A\A]A^A_@H="f1@'H|$(HcH'LD$(1AIxLIIǀHH)HfAhDfAAƅ H|$ H=' A 6H=n%EH IH1&fH=9%H zH}1&f.H= %H 2H1A &DgA]L|$ 1L|"A@M1ɺDAƅLAG A9GACGA9GACGD`IH|$f@H|$1A%D$l$efDHcL Aƅ9)uܽIDl$HHHI9D)AMILH H|$MH ¾ffI*H*^(L$H|$L$t~(u@9H)|$HcLyAH=#%H LH}1$|$t |$ !Lj@t]CMHHDHD$H=%HM1HHL$L@I@H9\$uLI9Dl$B1H5"% 1DAƅL|$=A L@A AHDAH=%H *H1Ai#T@H=%A1H H<#H=I%M11Hy#L@躇D$ADH=A%H jHK1")fAH=%H ?Hp1"H=%H H 1v"LD$H=Ş%1H HAE"LMH=%H Hn1"ff.fAWAH>AVAUATUSH H8dH%(H$(1H|$HD$ HD$(D$0HH\$pHL$(DH;1HH$HD$@HD$ H -HD$`HD$0H\$xHHT$PH$H1H$HL$@H$HOH$HD$HnD$X D$hƄ$oDŽ$DŽ$H$Ƅ$lDŽ$ DŽ$H$"'Dd$0AAAE1H=Ҝ%H H_ U/H=%AH IHE1. H$(dH34%(|H8[]A\A]A^A_D$ Lt$(D$ H|$HcŅt6 H=*%E1H 6HLfDDLl$ÅtXMtLEDD$0H=ě%1H H,JHAA1AUt$E1D/wXZMAL1AąfDHcLDADž9)uDuMH=%H H1j7DAtGLM L?f.ku@L$ H%H51AUH51AUH51AUH51AUH51AUH51jAUH51RAUH51:LRDH=%E1H HAH=^%M1DH OH.H=2%1MH &H.MtLDd$0_f.AW1H tAVAUAATUSHLLDg_ Ho`LH=% MMMH 1H=%I躀1H tH=}%Aغ1H (H=%Aغ1M)H sI)H=C%Eź1H H=%cHE1[]A\H H=%A]A^A_3M1H EsH=3%fAVfAUI1ATE1UHSH0dH%(HD$(1)$)D$A1E~#H DmDHAEx=u9H1fAEHL$(dH3 %(DuH0[]A\A]A^DHfUASH HdH%(H$1HHH5%H$H1AH H5[%Hf=D%Dt'H$dH3 %( H[]fD %fQw2fQfQrfQvfQf뚐1fTtwfTfx1fT_fDHAH s1H5o%HfDHAH 1H59%HfDHH ID1HH5W1HHL31H DHH5 1HfHH=1HDAWAVAAUMATMcUSH(T$ H $dH%(HD$1H@E1AىHDIOpD$AG AWAw AO  AG  AGD$AG f9CfL$f9BfD$BDdf LAAEHcIHE9}tZK41L@ L;H=VD Aa@H=)LDE1@H=E1)@H=fL1H5>Hڿ1H5(BH=RA+gAWAHAVAUATUSHdH%(H$1HH$HD$ HHD$(1HHEH 1DH$HH$ HD$ H$0HD$(H$@H1H$HH!H$XH$H$hHƄ$fDŽ$(DŽ$8Ƅ$PsDŽ$`DŽ$pH$xdAą9H\$(HH}1H<HHH7 HtH\$(f.HT$(H=0H H=0HH=HD$ YH|$ 11[ÅH$ƿmUL$DAhMcH|$HcLttD1A H=%H"0H$dH34%(DH[]A\A]A^A_@D$ :D$ *Ll$LLI9E1E!Hc)AIŅ9LDDO݉iADžyH=NEL7H 4%H=.AH=ADD1AH=с%HaeH %H=.AD$ fDHT$0)D$`ANHD$`1)D$0)D$P)D$@HD$pD$0D$XAč"H +%:E1H=_DEH=%EHH1}AWfAVAUATUSHHx|$@t$dH%(HD$h1)D$ )D$0D$F)D$@)D$PHD$`D$<D$E1D$D$HE1E1@Ll$ DLD$ MI\fH|$wD$L|$LANHD,HL$8D$$Dl$D:LDHI 9l$ID$@fA)$A)D$A)D$ A)D$0;l$D$EPD$  T$ |$T$HMʀT$HHUH\$PK@D$1T$D$t'L$AD$|$ 1;L$vBH\$hdH3%(uEHx[]A\A]A^A_ÐD$L{D$L$E1D$D$efDAWIAVEAUATU1SHHH|$H\$0HL$dH%(H$81BHD$(HHDHD$fDEoEtnM'AA`AAAAA0ffDH5LDHt1IL9|$tLH1HEhEo cH|$HH1LII3L9|$uH$8dH3%(HH[]A\A]A^A_fH5LaHt$HcH M3L LDHtH1MH fDLH51ZDHT$HcLH1H YX)@HcHD$T$(P@fT$,D$.LD$(f.MHL$HcDDH I fDHT$HcH DH1+HT$HcH DHT$HcH DDAWEIAVAUATIUSH1ɺ2H5c%MuH[]A\A]A^A_LHh%LH-%HSHH1HÈL9uH[]A\A]A^A_DD$ /I/H/H5LHI10DD$ HL2H5b%6Mt@LHg%LHsH1H1HÈf0L9uHL12L15 +HL[]A\A]A^A_/DAWAVAUATUSHH $H@H4HdH%(H$1L$AILL$H\$H@LHH|$ HHL$DD$fHsD$(HD$HܽHD$ HD$HD$0HnD$8HD$@Ht$H=AH$ÀmQۉŅHcy%HT$H5VI<12|$iŃH1E1AUADTY^A}$[@ED~1H$dH3%(HĘ[]A\A]A^A_DH5O1뛐HE11ɺAVADSXZ$[‰օU1ɅLAL9DJ@H= 7D(f.L@H-d%LL5tu;HUHL1HňI9uD1+I+H+H5LIH1-HuH1H1Hň,L9uHھL1G/1L11 LY,D*H= AWAVAUATUSL$HH $L9uH HWfHDdH%(H$=1AH$,IH|$0HT$pHT$xHT$x)$*DŽ$*HH$`H|$HH$HH$HH$HDH$HH$HH2H$HH$H$0HH$HHH$`HH$HH$HƄ$DŽ$Ƅ$Ƅ$Ƅ$Ƅ$DŽ$ Ƅ$(DŽ$8Ƅ$@Ƅ$XƄ$tH$HFH$HH$HD$pH$HUH$H$H$HH$HwH$HsH$ H1DŽ$DŽ$Ƅ$pDŽ$DŽ$Ƅ$dH$DŽ$ DŽ$(H$0=HD$p8$KHD$x81Hcs%HT$`H5I<1|$`D$$H$ HHD$KAąu/$ H=AbH$=dH3%(DH=[]A\A]A^A_fD H=5H€u=DŽ$$mHD$x8HƹH= 6tH=A>HL$hLD$d1$D$D$dHD$hAąueD\$dE~[H|$htSLt$0D$1H LH|$hHL$xMt$dHNH|$h@@H=$/Ht$1LH~HFDH0HApu Hc4*HH9uHD$HcɺH$*Ƅ *HxHl$x/HH# \HIHH=qLt8UHEfDHPh\u8\ufDH$pHD$PH$+L$=HD$@H$HD$(H$-HD$HH$1HD$1HD$hHD$hHHD$8QHtEHHLfo=A4IHHB: 1.fDJHT$H|$LH GL$9L$5UHLLD$HH$HwH$HL H$HaH H$HH$HHH$HQH$H_H$HkH$HlH$HuH$HH$HH$HH$HH$ HH$(HH$0HH$81`HD$(\$XHHpIHI9H5LHMH<HH1H/HuLL1MLLLtH=1n%L1HHI9kD$`\$XL fHDŽ$ 5L$9D$X1HL)$5HH|$H)$5)$*Ƅ$(5DŽ$*Ƅ$*HDŽ$*Ƅ$*QHIL LIH ,1H5L2HH4HD$(LHp HD$H$*HHL$HHpHD$L$*LLD$Hp@fo Lfo f$4=H)$=)$=)$ =DŽ$0=****?LD$LHAPLPHL$XHQH HPHATPD$1H0HLfo 7HLfo Ƅ$4=)$=fo !)$ =)$=DŽ$0=*** %LD %H )LPH0P17_HAXLIHQL9$ A1Lt$(xAD9$ rgLH1HDLCuELH RAHT$LLLҸMD9$ sHT$(HD$ DoIHtHD H`LJHT$P4D$hHH$pHjGRHt$(HH$pHI1@HHHI H$xHt$8IHn1H[It$hL$  1LAH LL|$HEHcD$hH$HH$HeH$HH$HH$HH$HH$HH$(HH$8H4H$HHUH$XHvH$hHD$(DŽ$LHhDŽ$DŽ$MLd$8DŽ$DŽ$DŽ$DŽ$DŽ$ DŽ$0 DŽ$@ DŽ$P DŽ$`dDHAE1E1AT1ɾjj.LH rH=g%AD1HHI9D}AuHE1E11ATt$ hKH uAL1H ƿHL}MLHT$LHT$MLH|$I9bt$$L|$D$HoHNHeƄ$H$H"H eH$HGH$HH$0H H$HH$8H$PHH$HH$`HDŽ$Ƅ$DŽ$Ƅ$DŽ$Ƅ$H$Ƅ$H$ Ƅ$(Ƅ$@H$HƄ$XH$h: HƄ$pAH$xH?H$H~H$HH$HlH$HH$HH$HƄ$Ƅ$Ƅ$H$Ll$L|$81\$L|$0IHD$EAL$?E<H@HH[ H`HX$1wAu hAu U$?t@D%?))݅&HcIH DT$HE|$HDnfH$pHD$PHD$HpH H!%tH&DHJHDщHE11H)Ht$HfDMcAB+H9  wHr@ELH Ż1HMMLHT$r1fIL9l$tEeEH\$xH5M#L|$8HNHuLL$@L1IH LHT$(H޿`LD$@L1H Ǻ7LH=úA1Ic]HݾHIHHAE1P|$ 1D>A]^_)A<$ᆳusfDA<$ᆳtc)EH L1vHT$IMML H1DAT|$ AE1q=ZYtLSNfDIcE|$$HHD$0HHƿMceIHMJLl$X\$MHl$PLd$0L|$0I!A?ᆳM)MLD8tH\$PLl$XL|$0wH|$81L$0L$0AkHc^IHRHAE11AT|$ DCHHHHH ׾D$PDL$ 1DD$XHZH5vHHLd$XH¾LmHH1H=۽L1H5HtH$hdH3%(@Hp[]A\A]A^@IL H1H IH=ɳDH=^kffDHD$E1E1P1jjj;4H Åu\$t9~e-H=٥f.H=H=֪fH517AVAUATUSHH $H0fHHdH%(H$(1H$ALD$ H)D$ )D$0)D$@)D$PHD$`HH|$x D$HH_HL$pDHD$pHȕH$HD$H$HD$D$ H\$D$xfDŽ$DŽ$H$T$ Ht$H= ÀۃH)j$fD$%HfH$)$I)$)$)$I<H5/LHI1PDD$H1DL$@H H1LH51DD$ETDD$DL$DDt1@H1H ŨH1LH51LL11Lc  L1VT$L$H51+T$T$L$tH511ۉH$(dH3%(H0[]A\A]A^HT$1ANHHT$8HT$ D$ D$DD$P!HH=N%1wH@1H UH1LH51vf.H51H뀺/H qN%H=%AAWAVAUATUSHH $H@HdH%(H$1AH$L$HHT$LD$HD$H@LHH|$ HHL$DD$fHiD$(HD$HґHD$ HD$HD$0H4D$8HD$@FLHt$D|$AH=ԥÀAAtWH=@AuD-1DH$dH3%(HĘ[]A\A]A^A_HE11UA(AXZExODA|fH$$Aƅt:EyH=NH=ɸD\*H1ɾE1ATAD'Y^AƅuE1ELA1Ʌ1Ҁ$[1Du,HE11ɺ!H56%DfDH I3HߺH5̷IH1GE1LH!H5b6%LL11H HD7AWAVAUATUSHH $HHH-bHdH%(H$81H$ALD$HD$Hl$HH|$H HHL$@DD$HfH<D$XHD$@HHD$PHD$HD$`H̢D$hHD$pHt$HAl|$tc;H J%H=AxEtDH$8dH3%(DKHH[]A\A]A^A_HAE11SDV%AYAZAƅWD$$fAD$EIH 1%H5<1$0Dd$ HE1H$@1 HDCHH HD$ H HD$(HHD$0HHD$8A@EH >H1d$HH} HHS㥛 H#SHHHo^M<+ HHHHHHIHIHiH)HHHHIHH)кZHH)1QH 1LCH}1H *NlHCfL$H} MDH$1H $HDŽ$!HC&fMH}+9H H$1$IGDC.H}71H -C/Y^<LD H}@$1H QDC0fEH}I1H +gHHUR8u HH9uHAH@D9$Dd$ H=F%H1yssEI| pafEMEOxbE@| xxfUDEF5H=)F%1HqH F%3H=ȳkfDH=E%H1f A*H E%H=ADqATUSHH $HHHH-!dH%(H$1L$ALD$ LD$D$ Hl$D$HH|$(HH\$PHL$ DHJHT$XHwHD$ HHD$0HD$HD$@HD$HD$xHD$(oD$8D$HD$`sH\$hD$p DŽ$H$=LljyA$HT$H=tHHH H=>HL$HE1E1߃L$ HD$Pjj'H Aą.D$HH5HHD1H$dH3%(DBH[]A\fDHD$E1PjjjDL$8Ar$H AąugH=`[fHD$E11ɺPjjjDL$8A%$H AąubH=s6fH=)H=H=H=IAH51A5 ff.UfHvS1HXdH%(HD$H1HL$LD$ D$D$ )D$)D$ )D$0HD$@x|$ t5H=NHT$HdH3%(uEHX[]fHD$E1E11Pjjj"H Åu\$&fDATAHtUL%1SHcH dH%(H$1H|$8LD$ D$D$ Ld$HD$D$ HHH\$`HL$HD$0HH= |HD$@HD$HD$PHD$H\$hH`HT$xH$HL$0H$DH$HH$HD$8oD$HD$XD$pvDŽ$ DŽ$H$Ƅ$sDŽ$ DŽ$H$ËD$ @HT$H=bpHH=ЄHHLD$E1ɺ߾D$AE1 HD$Pjjj H ŅH=ıg H$dH3%(dH []A\T$HD$L$E1PjҍL jAE1j H ŅH=袾H=YԼfH=)ļ}XL$HE1E1HD$PjjV"H ŅudD$HŗH H5FHDʨHHHD1}OH=$6H=9 H51/訽~ff.HH=輻1HDtHHcH>HYH3HHH1HHmHKHHHSHYH8HeH;H2HHdHHHfH;H¢@@HHcH>HƶHH1HSH)HHܷHHHHHbHH&HHHHHH!HHڵHȷHHHNHٻHHHxHŵHH3HHHٻHHH{HQH@HHkHHHH_H1H5ͻ;1H@AWAVAUATUSHH $H HdH%(H$1HؐAH|$(HD$1HHL$ DD$(oHY|D$8HD$ HS|HD$0HD$HD$@HD$HHD$PH1ɾAE1H$SY^AŅL%3Ht$L IHD$,H5QLHI1@$tnHE1fD AHH5#H1;H 1H5HH1HL1AD;$rH|$1{ 衴@~(nH=6%EHH1NH$dH3%(DHĨ[]A\A]A^A_f$H51-H 1HH5 и-u $1H-u`fD9$JHt$Lt؉HL4@1IB4OB4RH5uH1,腴DAWA H+AVAUATUSHdH%(H$1HэH|$8HD$(1HHL$0DD$8oHUyD$HHD$0HOyHD$@HD$(HD$PHD$XHD$`H]Ht$(HH$rD$D$D$H1ɾE1L$AAW(D$Y^MoE1E1I<I M9AEH #HL@1H1H5iH51Q(H1L P5%LA5%H (Hڿ1H5 8H e#HL@1ߠH1H5ɞH51豞(H1L 4%L4%H p舠Hڿ1H5r 蘙H Ů#HL@1?H1H5O)H5D1(H1L 3%L3%H ЛH1H5Dҝ H1E1H$AP|$H=zAXZHt$(EGXH=#H Ϛ1HOH5ΚBHКH5U1($H51 3$1HH5Hڿ1H5o˜ HH5ԙ1觜$H571茜 貗HӠH51hH$1H$H5,E kHH5N1!H$1H$H5 $HߙH51ڛH$H5j1进 HVH5Ș1蛛H$H5+1耛 視7$g@$@$r@$'@$@$ @f$IH$AG$sH$H0%g9HT$xHH$HL$ H$HuED$(nD$8 D$HD$`iD$p DŽ$Ƅ$bH$D$ NjD$HE1E11ɺD$ H$Shjt$4EH ADžv$ L$D$H޿,HmT$pH$XDD$L,$AWH5,1ωDHHAτ9\$\$D)OAA McL蜇HHT$HE11PDATjLD$ t$4|$,8H AƅAK;H=%EHH1LDt$ H$dH34%(D$ IH[]A\A]A^A_ҘH=+%EHCH1貉D|$ DD$L$1H!%H5u$ 1$H5ǍD$ IH߾DH=L茈D|$ fLHH=3DH=KLH 9%H=裈D$ QD$ f.HHHcHxH~ HfDHf.DAWAVAUATU,SHDD$ DD$ 96AD}AD`HI)H=AH謂D9tgDLDH5 D!1轆J1H5覆E9u|$ t AH踁D9u|$ uH[]A\A]A^A_f.HH=Ɩ[]A\A]A^A_fDATAUHHSӍT61H dH%(HD$1H01234567H$H89ABCDEFHD$%D1At$HA)IDHDAAFDyDyHH9uHD$dH3%(u H []A\fDH@<7 u 7HuATIUHH5PSH觅HtHHLTH\1[]A\HH51AWAVAUATUSL$HH $L9uH fdH%(H$x1H\$ IAH$IպH)$pH HH HHH?I6HH&IuL$pHLH5L1L1LDH$ }LDLS{L L$0LL\$H$p2L (LLT$fO1H$])$p]詀f1OH$1)$0)$@)$P)$pf$`gf?1H$)$pG1fH$)$pHH-~L2H|HHP1ATPHLL}L$]PHLaL1ҾH$L$HHD$*L1ҾLAVHD$ HPPPL\$8Lz1ASSLT$@M0}HLH0P|LLH$xdH3%(HĈ[]A\A]A^A_fo(reHyour tes)$ HEEt hefUECfH5%LQH@H=,}afH=I}I}DAWAVAUATUSHH $HH $HH $H8fdH%(H$(81Hl$IH$0#)$ #L$ #H HHH肀I4$H Lh1qH$ 1HƉH H H!g H H (1fH$0(1)$ (D$!HH$0$~)$ $HAHIHH5 $2HH$HhfH*L$H$ $HHHPH HjL LP1U$8zH0HL$ (L~LHߺD$^DyH޺LyH1D$!LyHLFyEHL1cyHLyH1D$!LlL7!#yHLxH1D$!L;xHLxH1D$!L xHLaxLH'!D OKHT$D$H9uHLH1<$MxLHw_HG!AX JHT$D$I9uH1<$LHwHLwZ^HW!HG! JHT$D$H9uH1<$LAHwHL5wA[A^Hg!HW! JHT$D$H9uH1<$LHwHLvAYAZHw!Hg!f IHT$D$H9uHLH1<$vLH]v_AXH!Hw!f. ?IHT$D$H9uH1<$LJH=vHLuZ^H!H! HHT$D$H9uH1<$LHuHLuA[A^H!H! oHHT$D$H9uH1<$LHmuHLuAYAZH!H!f GHT$D$H9uHL[H1<$tLHt_AXH!H!f. GHT$D$H9uHLH1<$E1tHL:tH1D$!LȋRtHLtH1D$!LtH޺LsY^OfDH-EHPL1IsHLsXZItHBu!uEHL!IsHL5sIuH1D$!LaGsHLrH1D$!LLsHLrH1D$!L<rHLrH1D$!L,rHLOrE1ɹHL?1lrHLrL/wLWrLLH$(8dH3 %(H88[]A\A]A^A_HƒfHH H*XD$@H5! %Lv,@H=trH=Q\rffH=YDrNf.H=4$r.H=rrff.@AWfAVIAUAATUSHdH%(H$1H\$ H$)$L$Hl$HD$0HD$8HH CLHL$ H <HL$(#HHzHH NH$H%H$H$HCH$H\H$H 8H$H.H$Ƅ$rDŽ$H$DŽ$Ƅ$fDŽ$DŽ$H$Hq*H$HCH$HHH$ HH$(HH$8HCH$HHƄ$oDŽ$DŽ$Ƅ$0nDŽ$@DŽ$PH$X&sHH$vofoHoH=k %)T$@oX)$)\$Po` DŽ$og-)d$`H@0HD$pnHL$@HH̆sH5 %HHH!%tDHWHDºHH)HHdrƄ$DŽ$.txt.txt$PAfLHLDzAąvH='L$nL1H5LkrD$ H5rD$(H5rHKLLDD$ 2L$ YYD$(H,H,HHD1MqH=$Hq:@LLD HL)H9HO؉sH=W$bq1pIH9DoH$dH34%(D$ uyHĸ[]A\A]A^A_fIvH$qDH=tmfH51qDd$ @DoD$ pmfDAWAVAUATUSHH $H fH,dH%(H$1H$`)$`)$p)$HDŽ$xD$H$ |$HpD$ LsLcLL=EQL$0L(H$1~fH$)$H5i$HHL$0LH$Hݍ*H$H H$H2H$HsH$HH$HH$HVH$HH$HH$H H$H*H$HCH$H|H$HL$8L$@L$HL$PL$XL$`L$hL$pL$xL$L$L$L$L$L$H$HnH$HH$HH$HِH$HH$HSH$HH$HH$H֑H$HH$HH$H9H$HrH$HH$HԒH$HH$ H&H$(HGH$HpH$HH$ HH$(HH$H,H$HmH$HH$HǔH$HL$L$L$L$L$L$H$H!H$HH$HHD$ HGHD$(HHD$0HǖHD$8HHD$@H7HD$HHHD$PHHD$XH;H$HlH$HH$HH$HߘH$ HH$(H)H$0HJH$8HcH$@HH$HHH$PH֙H$XHH$`HH$hH1H$pHH$xHH$HH$HH$H.H$HGHD$`H{HD$hHH$0HțHH$8HnH=H$@HМH$HHAH$PHbH$XHHD$pHǝHD$xHH$HH$HQ~H$H^H$HH$HA~H$kfHH߾VH1H5~jHH{*H1H5TjL1H5}L$6jL1H5} jHK@1H5jHH{HH1H5}iHH{IH1H5iH=D$lWeHH{LAH1H5Y}kiA1DH$HH{MH1H5g"iHH{N1HH5|hHH{PH1H5|hHH{TtH1H5hHH{XHH1H5rhH=+D$|dHH{\H1H5 |2hADH$0H=>|D$cHH{`H1H5{gA1DH$uHH{z_H1H5~gHH0H1H5ZgH=D$ cHHH1H5{g1ADH$ HHH1H5OfHHqH1H5HfH=zD$$FbLHLϾLL$%H1H5=zOfE1L1DLL$HL$$H51fLDAH=HzD$%aHHwH1H5yeA1DH$DHH+H1H5RUeHHH1H5K&eH=oD$(`HHH1H5xdA1DHL$ H=ID$)s`HH ZH1H5rxdA1DHL$0*HH H1H5;dHH H1H5  dHHH1H5cHHH1H5cHHUH1H5cHH&H1H5PcHH(1HH5!cH=2D$X^HH8EH1H5vAbD1H5 bAHLuMEǹ1L=y]HDH51vbD1H5vZbD1H5vAbH=r]HH<H1H5bH=ϛD$^]HH>H1H5uaA1DHL$@hHH?OH1H5vyaHH@ H1H5wJaH=D$b\HHBH1H5taA1DHL$PHHDH1H5J`HHFdH1H5S`H=FuD$h9\HHH H1H58tJ`A1DH$H=D$ [HHH1H5s_D1H5t_AԿ1H5ۚ_H=tj[H=D$!U[HHQA lH=lH\$E1A.QH=slQH=jlH Q1H5il1Ƅ$@U@H1H5BlULH^AGI At Iu PAIu Ƅ$ L%VPH51UL1HTu PH uHPH=kP|$KRH$dH3%(D$ HĨ[]A\A]A^A_fD1HH5=TItLH5$k1cTfDÉH5p1AT\$ mH=dO|$QD$ KqPE1$Q@AUA1HNATUSH*HdH%(H$1HRH|$0HD$HD$1HHL$H\$`H=6HL$PH HL$HD$ t$LLH=$@;1HbL߻HH $H=L߻Hf|$t$LnsH KfLزk.Gff.UAH<SHHdH%(H$x1H|$D$ D$HH\$@HL$DH[HD$nHD$HHD$ HD$HD$0HD$ HD$hHD$( D$8H\$HD$PbHD$xQH1ɺH$AE1St$ ZYŅD$ t6H蹱H$xdH34%(HĈ[]fDL$H$H5.Q1rIH=k&EH{-7$H5H1?IH{7$H5H1I$1D$$H5D$HH{)6$H5H1HH{56$H5ϔH1HH{A\6HfH*YV$H5ZPHH{M6$ H5ӔH1)HH{Y5$H5H1HD$&1$%$#H5GH{q5$/H5H1GH{}w5$;H5+H1GHM5$GH59H1_GH#5$SH5OH15GH4$/H5eH1 GMfDAWH=[$AHsvH1GDHƒfHH H*X0CDATfHUSHdH%(H$1HL$p)D$p)$)$HDŽ$MÅxdHE11L$AATHXZt`VH=g$AHH1FH$dH3%(tH[]A\fH 1fHH$H *H&H$H $H5qH$H H$H H$H H$H$H HD$PH2H$H H$ANHHD$XH)$)D$0H$HD$`)D$)D$ HD$@$D$0蒎ÅT$DHH԰ $[H5֔1D$'H5+Hİ1_D$H-H!HEH5&12Dd$$dH5.G1D$Ht<HPH@HEH5!1C$$H5)‰$$1C$+$*H5‰$)$(1EC$/$.H5‰$-$,1C$0H51B$2H51B$4H5$1B$61H57B$8H5N1zB$9H5c1_B$;H5x1DB$=H51)B$@H51B$AH51A$CH5̕1AIL$E1H5ݕAIL$M1H5A$\<HTPH51vA$]H5?1[A$cH5T1@A$eH5i1%A$gH5~1 A$l$kH5‰$j$i1@IL$m1H5{@@fH51}@H=$<s1>$H581>H=:fLL1H>H uH=1L-\:@L1H|>HuH=Ϙ1L-ɔ!:L1HD>HuH=9$<11H5>H=9$@11H5[=H=9$D11H53=H$HdH3%(DuOHX[]A\A]f~MH=$EHmH1>@Hc9ff.UAfSHHHdH%(H$1H|$H)D$)D$ )D$0HH\$pHL$@DH$HtD$HbHD$@HD$HD$`HD$ H$H<H\$xƄ$jH$"DŅHT$@N019ŅHL$(H5'Hɥ<HE-HHH1H H2@fHƒfHH H*X^$ff.fHXfdH%(HD$H1)$)D$ t$ANHHT$(H)D$)D$0HD$@$qHL$HdH3 %(uHXT$@AVA*fAUATUSHH dH%(H$1H$)$HD$HHH$H tH$HH=H$HHUHPH$H 6H$HH$0HPH$PHP H$H=QH$HH$(H]H$H^H$`H$H$hDƄ$cDŽ$ DŽ$Ƅ$zDŽ$DŽ$ Ƅ$8fƄ$pbH$H$HH$Hh&Ƅ$jH$-AąH $ŋT$HH HIؿ1AZH5~Lt$ A@N0&f)D$ )D$0)D$@A>'1LL#uHD$0HH9HH9vLd$8IL9D$<HھAą l5H=Ţ$EHp}H1L&H$dH34%(DH []A\A]A^fHiHðRHH|$P%0HLD$xL)HL9w I H=knAUATUSHH $HH~dH%(H$1HAH|$H$1HH+DH HD$HHD$ HHPHD$hH HT$0H2HT$XH_$H\$@H HT$xHH$HL$H$HHD$D$nD$( D$8H\$HD$PoD$`D$pƄ$rH$!H<$t$AŅulcʼnƉD$L$ HL$AE1ATrXZtT~bb- 1bH$dH3%(uZH[]A\A]fDDL-H=J}f.H=Tmff.fAWAVAUATUSHH $HH|ifH+dH%(H$1A)D$`H$)D$p)$)$HDŽ$HH$H|$pH|H$H|H$H$HH(H$ HXH$H H$H|$xH$PHCH$H$0H$@H=2H$XHVH$hH$H$HD$`H$Ƅ$nDŽ$ DŽ$Ƅ$sDŽ$DŽ$Ƅ$(zDŽ$8DŽ$HƄ$`yDŽ$pH$xH H$H=v{H$H{H$H$H=~H$HfH$HL$hH$H$H$H=HH$HUH$ H$H$0H=H$8HSH$XH$H$hH=]H$pHQH$H$H$H$H$H$H= ~DŽ$Ƅ$dDŽ$DŽ$Ƅ$MDŽ$DŽ$Ƅ$lƄ$@fƄ$xrDŽ$ DŽ$H$HrH$H$H$(H$H$8H}H$HHyH$PH$H$pH}H$H$H$H=E}H$HH$HH$H$H$DH$H}H$H~Ƅ$mDŽ$ DŽ$Ƅ$aDŽ$ DŽ$H$Ƅ$ pDŽ$0DŽ$@Ƅ$XPƄ$tH$oH|$x$u]ʼnƉ$H$1҉iŅY$AL|$xH AAT$L&DEEt0A#H$HAH1HH$<H|$`H11D$L|$xH|$0LHHHD$QD$ H=$L1HwH|$`t|$wi1 3H$dH34%(H[]A\A]A^A_h&fDD$6EH{H=ߏ$1s cH $H=v .fDHD$0L1HHHD$.|$HLŅH|$hHt11D$H$E1HHD$x1ҋ$Ih$ AątfA$tfA@$>H|$@1ZHEHD$0PAWH$Pt$(H$P$P$PD$H$$~H@1H|$P $H $L H|$ht |$1H|$ fELHyfD$H=ٍ$Ⱦ1Htc SH=t?fADH=t|=Ht$AH|$8 D1H=?$HyfDHT$(H5y1HT$PH|$@Ht$HHL$XH50yH1i@H|$`aL|$8H1Ln |$HL ŅsH=sJ@H=VtNH|$h`F fDUSHH $HH $H1dH%(H$ 1H$|dXueHeFuf$HHDH$ dH34%(uIH []f."H=sH=rf fDAVA#fAUHHATUSHqH@dH%(H$81H|$ )$)D$HHfH\$PH(HD$ HH=HHH\$XH޽HL$@H wH\$hHH$HHHD$xHH$HpH$H wHT$0H$DH$HL$ D$(nD$8 D$HD$`sD$pDŽ$Ƅ$dDŽ$DŽ$H$H$H;wH$HDmƄ$tDŽ$ DŽ$H$Qt$ÅuUʼnƉD$`iAąſHO IHH|$H511L AƅaHLD ŅAU1ɉAATDD$(HT$t$w߉XZ= wH|$tD L2D2H $H=vV 1+H$8dH3%(H@[]A\A]A^Ð{L$H$1H5v IH=$T fE1H=64 H=o H|$ @H=au ff.fAVA8fAUHATUSH7nHdH%(H$1H|$@)D$)D$ HD$0HH\$pHL$HH\$xHIHHL$`H=sHL$H$HnHD$@HD$H$H=nH$HnH$HL$HT$PH$HD$0H$H=nH$HMD$HnD$X D$hƄ$sDŽ$DŽ$Ƅ$aƄ$zH$H$HL$ H$H=pH$@H tH$ HUH$PH=tH$hHL$(H$0H$XHӿH$xHL$@H$DH$HmH$HiDŽ$DŽ$Ƅ$(lDŽ$8 DŽ$HƄ$`dDŽ$pDŽ$H$Ƅ$tDŽ$ DŽ$H$i1L$ýDL$EALd$(MDl$ 1EL$ATPDD$@HT$ t$(s߉XZ/)H|$(tDLaQPʼnD$UH=W'D7H t$H=rg1 H$dH34%(H[]A\A]A^@ D$ ut$D$ )LcIH|$LHcAŅ~H ǃ$!H=q1N@T$DL$1H5rDD$HL$#H l$H=PqLd$L1LH|$(Ht11AŅx~Lct$ LLDaŅx+D$ DL$@H=jH=1H $-H=p+HH|$(fAWAVAUATUSHH $HH $HHh?fH?dH%(H$x"1HAH|$pHD$@1HHL$PH$H(H$HH=hH$HL$HH0H$HH$H$HL$TH$H=opH$HH$H$(HT$XD$HHD$pHD$@H$H H$H=`iH$HD$?D$XD$TD$xnDŽ$ DŽ$Ƅ$sDŽ$DŽ$Ƅ$dDŽ$ DŽ$Ƅ$ SDŽ$0 H$8HdH$H$HH=H$HT$\H$HT$`H$PH hH$pHD$aH$H=poH$HhH$`HhH$HL$pH$DH$HSoH$HbhDŽ$@Ƅ$XoDŽ$hDŽ$xƄ$vH$Ƅ$eƄ$pH$( H|$@DD$\D$EtD$t$P|$`D$H$p1҉WAƅRt$PH$p?YAƅ4@$AHHHpHD$HD$Ht$E11j@1DD$ht$`n^_AƅeHD$Dd$THAuT$TAԋD$HT$ @D$Al$Ht$? }@HHT$ HHD$(DD$HHcҿ1H5fADD$ DD$ D$E1EDELl$(D$ T$EAE9C7D9vEl$E)A@L$`AUUDL$qDD$ht$`mZYjuDD$T$ DLD$D$ID$Aƅx*t$PDAt$?H|$(^H|$m1DH$x"dH34%(HĈ"[]A\A]A^A_ AgDIAƉƉD$PWH=sAHt$?x@HHT$ HHD$(t]DD$H1HcҿH5 eDD$ EEDD$ 4AH=A>fH=d$ f.AUA8fATUSHAHHC$dH%(H$1HJH|$ D$H$1HH׿H\$XH2bHD$ HͿH=HD$0HHHH$HHT$PH^HL$xHHH$HbH$H=cHD$@HT$hH$HHHD$D$(oD$8D$HD$`nD$p DŽ$Ƅ$sDŽ$DŽ$H$HScH$H=XcH$HHH$H=bH$HiH$ HHHH$8H=H$H$H$0HiH$XHL$ H$pDH$HbH$HbƄ$zDŽ$DŽ$Ƅ$SDŽ$DŽ$(Ƅ$@pH$hƄ$xlDŽ$ DŽ$H$H<$ĤL$l$Dd$@tiE1EujAU@͉ATDL$&DD$%HT$t$ hXZL41EfDEDIHuH=hH$dH34%(H[]A\A]@DʼnD$ H=WWfH=Kat<T$DD$1H5hHL$3H 4x$H=g@AVAUATUSHH $HH $HP#Hf^fdH%(H$H!1H:AH|$ H$1HH H H\$PHD$ H~HHD$0HH=/HPHL$XH HT$@HPHT$xH>$H$H H$HiH$HL$ H$HgH$DH$HD$D$(nD$8 D$HD$`vƄ$oH$DŽ$DŽ$Ƅ$HH$H<$¡T$AątAD$ tAt$uBÉƉD$L$@1҉LNÅuL$@t$LPÅtb~Px !1xH$H!dH34%(uPHP![]A\A]A^fH=@]fDLLH=tff.fAUATUSHH $H HgfdH%(H$1HAH|$HD$1HHL$DD$oHMD$(HD$HGHD$ HD$HD$0H<$D$8HD$@xgH|$L$LANŅtP~^ 1H$dH3%(u>HĘ[]A\A]fkDLիH=>]T=ff.fAVAfAUEATIHUH͹#SLHPdH%(H$H1H|$0)D$HD$ HHL$H=jZHT$@HL$PH HH|$`H=ոHL$xH M[HD$0HD$H|$hH=G`H$HL$H$HD$ H$H=[H$H H$DH$HL$0H$LD$8nD$H D$XD$psDŽ$DŽ$Ƅ$aƄ$tDŽ$ H$HVDŽ$H$HMM$AH|$H1?Ņxbt$uD>ʼnƉD$L$jDEjDD$0HT$ aYD^_ts~aH|$D?1H$HdH3%(}HP[]A\A]A^@HfDHDD$ H5QcPDL$,1LD$ HT$9XZafH=dNzf.ALlZ*f.AL[Z f.ALHZf.AL4Zf.AL"Zf.LUfHSLcH(DdH%(HD$1G)$HPGHP1XZHt3H1H5cH1-&HD$dH3%(u%H([]fDHH5c1HcHvHtHDf2PfQ@A@AWAVAUATUSHH $HH $HHHPcdH%(H$ 1AH|$(D$D$HH\$PHL$ DHH0D$(nHD$ HIHD$0HD$HD$@HD$HD$xH&H\$XD$8 D$HD$`bH$ÅxgH1ɺE1L$AAUt$(JZYAƅtgEADbH=n$EH H1BH$ dH3%(H []A\A]A^A_D$dH}$D|$HD$ IH$HJFAƅH  $H$ LP$P$$P$+P$2P$9P1D$@[H0HT$1DH5,H=1HLL`HA$H5/;H1HLL*HA$H51;H1HLLDMM1DEA$H5+;~HLLH3A$H5J;H1HHLLHA$H5L;H1HLLOH}HHA$IH5T`H1HL L HA$H5q<H1HL LHLA$H5{<H1aHLLHA$H5_H1+HLLhDMM1DEA$H5_HLL/DMM1DEA$H5_HLLDMM1DEA$H5`HLLH5A$H54`H1JHLLHA$H56`H1HLLQHA$H58`H1HLLHA$H5:`H1LHD^L1TJAWAVIAUIATIUSHHxHcH:HLHSHH5xHHDL|ID$I]ImL5_HD$MgH5_L}HADM|LHkL#LWAM|H5L>HHAL}M|HL)HH;D$A߀[@<"@`'<ULLHt%L;HkAM|rH H[]A\A]A^A_@HE1HEH[]A\A]A^A_H[]A\A]A^A_ff.H=uf$@AWAVAUATIUSH9~H5g$ 9uA<$ALA@u,D@ t0H5g$vA?L@Lz@ AuALD)DD4HuL)D)B 2L9~AH5,g$ ~1@H5g$ 9uA?L@hH[]A\A]A^A_L)D,E1uATUSHH $HLdH%(H$1HI$ [ D$MI\$H ]HHHHËE(J} ] H5*f$LH}0t+HS(H=\L)H}0,,H5e$ H$dH3%(]H[]A\@DGI\$EnH߾1HH C\HE(u7HEHL \H \HHLE1HHËE(HEHL[H [HHLE1HHHEHL[H [HHLE1aHHËE(HEHLM[H X[HHLE1!HHÀ}K,HDEfCVfDU1HSHH5[HHb$11H* Ht-H;t'H=ZYH;tHH84H;uH[]AWIAVAUIATUSHX|$ HT$(dH%(HD$H1D$<MMHD$M2L1H8jH8uz\mHcHcHLL$HI HMHLL$t$BH=K\$HSH1A.HLHq-qTH [$H=RZHcD$IvHI^I;t6L|$  fHIv1I^I;ufIM|$L|$ MH|$(dH3<%(A$H8[]A\A]A^A_fH߉T$HtHcT$tH9sHcHI^`IvH;f.Iv1HDHt$ L;%/M~HL|$ DHL-;ff.HHwH?1ff.HHwH?HHwH?xDHI1DEt**tN?t1A8t,teEAIqHIEuր*tTfDDFQHHDQHytHIf.QfDUSHHH^H)HtH9HjHHBH1(HH[]ATIUSH_H+HHHHtHLHH[]A\@H?Ht OAVAUATIUSHH0H$L$L$t@)$)$)$)$)$)$)$)$ dH%(HD$x19=O$H$HD$6=k$D$PLl$P=k$R=j$D$@1Lt$@1HHMLH HHUHDHH$H1IuH$H$`H\$LHD$0HL$(H$HD$(D$,0HD$8LD$HHMLDH $HHH=N$HHHHD1xH HHD$xdH3%(H0[]A\A]A^@Lt$@HD$L4Hw#Lt$@L)HLcȹ1L1Ҁ=wi$oi$|tDHt$Ll$PH LHL$ LGHS㥛 HH?H1HH)ʹ RLL$ bXZH|$HHaIRef.fPX7H=}GHH RM$(AUATUSH0HHHHE1;L-`GHuAHxLHuHMcJ| H HDH H t+Hr\t"u\HzHH  HHuHEHH[]A\A]ÿHFfH1HH[]A\A]S_ HG(tHH ӃHA(I uH@Hx D[SHtJO HG(1ۅu"H@HP HtHB(R tHx \[f.1ۉ[f.H()HtHf.f.UHSHG~"1f.HEHAVAUATIUSHHcH>LoH=1E1[AM~pIEL<(AW IG(PH@Hx Í@$H5<1KCIEL<(LLAME9u H-BI} IX~fH1uH][]A\A]A^A_HWH5=H1[]A\A]A^A_HWH5HWH5g=wH5b=1woH[]A\A]A^A_HH[]A\A]A^A_IfH=B9HHx _Í@Df.DAWIAVIAUAATL%t#UH-#SL)HHt1LLDAHH9uH[]A\A]A^A_ff.HH/proc/device-tree/ibm,partition-uuidnqn.2014-08.org.nvmexpress:uuid:%s Disconnect from all connected NVMeoF subsystemsDisconnect from NVMeoF subsystemDiscover NVMeoF subsystems and connect to themSend Get Log Page request to Discovery Controller.hostnqn is not available -- use nvme gen-hostnqn %s is not a block or character device Opcode or Feature Identifier(OFI) specifies the command opcode or Set Features Feature Identifier identified by the Scope field.[0-3] Interface (INF) field identifies the interfaces affected by this command.[0-1]Prohibit(PRHBT) bit specifies whether to prohibit or allow the command opcode or Set Features Feature Identifier specified by this command.[0-15]Scope(SCP) field specifies the contents of the Opcode or Feature Identifier field.UUID Index - If this field is set to a non-zero value, then the value of this field is the index of a UUID in the UUID List that is used by the command.If this field is cleared to 0h,then no UUID index is specifiedThe Lockdown command is used to control the Command and Feature Lockdown capability which configures the prohibition or allowance of execution of the specified command or Set Features command targeting a specific Feature Identifier.invalid interface settings:%d invalid UUID index settings:%d Lockdown Command is SuccessfulResource Type(RT): [0,1] 0h: VQ Resources 1h: VI ResourcesAction(ACT): [1,7,8,9] 1h: Primary Flexible 7h: Secondary Offline 8h: Secondary Assign 9h: Secondary OnlineNumber of Controller Resources(NR)The Virtualization Management command is supported by primary controllers that support the Virtualization Enhancements capability. This command is used for: 1. Modifying Flexible Resource allocation for the primary controller 2. Assigning Flexible Resources for secondary controllers 3. Setting the Online and Offline state for secondary controllerssuccess, Number of Controller Resources Modified (NRM):%#x identifier of desired namespacebuffer len (if) data is returnedtarget directive type to be enabled/disableddirective specification associated with directive typeshow directive in readable formatshow directive in binary formatSet directive parameters of the specified directive type.invalid directive operations for Identify Directives invalid directive operations for Streams Directives failed to read data buffer from input file %s dir-send: type %#x, operation %#x, spec_val %#x, nsid %#x, result %#x Read directive parameters of the specified directive type.Subsystem-reset: NVM Subsystem Reset not supported. Overwrite invert pattern between passes.Allow unrestricted sanitize exit.64-bit LBA of first block to accessnumber of blocks (zeroes based) on device to accessforce device to commit cached data before performing the verify operationreference tag (for end to end PI)app tag mask (for end to end PI)storage tag, CDW2 and CDW3 (00:47) bits (for end to end PI)This bit specifies the Storage Tag field shall be checked as part of Verify operationVerify specified logical blocks on the given device.The Write Uncorrectable command is used to set a range of logical blocks to invalid.NVME Write Uncorrectable SuccessSet DEAC bit, requesting controller to deallocate specified logical blocksforce device to commit data before command completesThis bit specifies the Storage Tag field shall be checked as part of end-to-end data protection processingThe Write Zeroes command is used to set a range of logical blocks to zero.Commit data and metadata associated with given namespaces to nonvolatile media. Applies to all commands finished before the flush was submitted. Additional data may also be flushed by the controller, from any namespace, depending on controller and associated namespace status.64-bit addr of first destination logical block64-bit addr of first block per range (comma-separated list)number of blocks per range (comma-separated list, zeroes-based values)protection information and check field (write part)protection information and check field (read part)initial lba reference tag (write part)expected lba reference tags (read part, comma-separated list)lba application tag (write part)expected lba application tags (read part, comma-separated list)lba application tag mask (write part)expected lba application tag masks (read part, comma-separated list)directive specific (write part)The Copy command is used by the host to copy data from one or more source logical block ranges to a single consecutive destination logical block range.Comma separated list of the context attributes in each rangeComma separated list of the number of blocks in each rangeComma separated list of the starting block in each rangeAttribute Integral Dataset for WriteAttribute Integral Dataset for ReadAll the command DWORD 11 attributes. Use instead of specifying individual attributesThe Dataset Management command is used by the host to indicate attributes for ranges of logical blocks. This includes attributes for discarding unused blocks, data read and write frequency, access size, and other information that may be used to optimize performance and reliability.failed to allocate data set payload Releases reservation held on a namespace by the given controller. If rtype != current reservationtype, release will fails. If the given controller holds no reservation on the namespace or is not the namespace's current reservation holder, the release command completes with no effect. If the reservation type is not Write Exclusive or Exclusive Access, all registrants on the namespace except the issuing controller are notified.NVME Reservation Release successreservation registration actionchange persistence through power loss settingRegister, de-register, or replace a controller's reservation on a given namespace. Only one reservation at a time is allowed on any namespace.Obtain a reservation on a given namespace. Only one reservation is allowed at a time on a given namespace, though multiple controllers may register with that namespace. Namespace reservation will abort with status Reservation Conflict if the given namespace is already reserved.NVME Reservation Acquire successOperation to be performed by the controllerValue specific to the value of the Operation field.Least significant 32 bits of the capacity in bytes of the Endurance Group or NVM Set to be createdMost significant 32 bits of the capacity in bytes of the Endurance Group or NVM Set to be createdHost software uses the Capacity Management command to configure Endurance Groups and NVM Sets in an NVM subsystem by either selecting one of a set of supported configurations or by specifying the capacity of the Endurance Group or NVM Set to be createdCapacity Management Command is SuccessCreated Element Identifier for Endurance Group is: %u Created Element Identifier for NVM Set is: %u size of buffer (prints to stdout on success)security-protocol-specific (cf. SPC-4)Obtain results of one or more previously submitted security-sends. Results, and association between Security Send and Receive, depend on the security protocol field as they are defined by the security protocol used. A Security Receive must follow a Security Send made with the same security protocol.NVME Security Receive Command SuccessNo memory for security size:%d Transfer security protocol data to a controller. Security Receives for the same protocol should be performed after Security Sends. The security protocol field associates Security Sends (security-send) and Security Receives (security-recv).WARNING: --tl not dword aligned; unaligned bytes may be truncated Failed to read data from security file %s with %s NVME Security Send Command Successstarting dword offset, default 0Copy all or part of a firmware image to a controller for future update. Optionally, specify how many KiB of the firmware to transfer at once. The offset will start at 0 and automatically adjust based on xfer size unless fw is split across multiple files. May be submitted while outstanding commands exist on the Admin and IO Submission Queues. Activate downloaded firmware with fw-activate, and then reset the device to apply the downloaded firmware.Failed to open firmware file %s: %s Invalid size:%d for f/w image [0-7]: firmware slot for commit action[0,1]: boot partition identifier, if applicable (default: 0)Verify downloaded firmware image and commit to specific firmware slot. Device is not automatically reset following firmware activation. A reset may be issued with an 'echo 1 > /sys/class/nvme/nvmeX/reset_controller'. Ensure nvmeX is the device you just activated before reset.Success activating firmware action:%d slot:%d, but firmware requires %s reset Success committing firmware action:%d slot:%dDetected an overlapping firmware/boot partition image update command sequence due to processing a command from a Management EndpointDetected an overlapping firmware/boot partition image update command sequence due to processing a command from an Admin SQ on a controllerMultiple Update Detected (MUD) Value: %u timeout value, in milliseconds[0-63]: LBA format lower (LBAFL) and upper (LBAFU), mention directly LBAF format that needs be applied (required)[0-3]: protection info off/Type 1/Type 2/Type 3[0-1]: protection info location last/first 8 bytes of metadataAutomatically reset the controller after successful formatThe "I know what I'm doing" flag, skip confirmation before sending commandRe-format a specified namespace on the given device. Can erase all data in namespace (user data erase) or delete data encryption key if specified. Can also be used to change LBAF to change the namespaces reported physical block format.Invalid specification of both LBAF and Block Size, please specify only one Invalid value for block size (%lu), must be a power of two Invalid namespace ID, specify a namespace to format or use '-n 0xffffffff' to format all namespaces on this controller. LBAF corresponding to given block size %lu not found Please correct block size, or specify LBAF directly invalid secure erase settings:%d You are about to format %s, namespace %#x%s. WARNING: Format may irrevocably delete this device's data. You have 10 seconds to press Ctrl-C to cancel this operation. Use the force [--force|-f] option to suppress this warning. Sending format operation ... Success formatting namespace:%x failed to set block size to %d failed to re-read partition table offset of the requested propertyshow property in readable formatReads and shows the defined NVMe controller property for NVMe over Fabric. Property offset must be one of: CAP=0x0, VS=0x8, CC=0x14, CSTS=0x1c, NSSR=0x20the value of the property to be setWrites and shows the defined NVMe controller property for NVMe ove Fabricset-property: %02x (%s), value: %#08x new value of feature (required)buffer length if data requiredoptional file for feature data (default stdin)specifies that the controller shall save the attributeModify the saveable or changeable current operating parameters of the controller. Operating parameters are grouped and identified by Feature Identifiers. Feature settings can be applied to the entire controller and all associated namespaces, or to only a few namespace(s) associated with the controller. Default values for each Feature are vendor-specific and may not be modified.Use get-feature to determine which Features are supported by the controller and are saveable/changeable.failed to read data buffer from input file: %s set-feature:%#0*x (%s), value:%#0*lx, cdw12:%#0*x, save:%#x can not allocate feature payload Indicate the namespace in which the device self-test has to be carried outThis field specifies the action taken by the device self-test command : 1h Start a short device self-test operation 2h Start a extended device self-test operation eh Start a vendor specific device self-test operation fh abort the device self-test operation Implementing the device self-test feature which provides the necessary log to determine the state of the deviceAborting device self-test operationExtended Device self-test startedShort Device self-test started[0-3]: current/default/saved/supportedbuffer len if data is returned through host memory bufferdword 11 for interrupt vector configshow feature in readable formatRead operating parameters of the specified controller. Operating parameters are grouped and identified by Feature Identifiers; each Feature Identifier contains one or more attributes that may affect behaviour of the feature. Each Feature has three possible settings: default, saveable, and current. If a Feature is saveable, it may be modified by set-feature. Default values are vendor-specific and not changeable. Use set-feature to change saveable Features.get-feature:%#0*x (%s), %s value:%#0*x File name to save raw binary, includes headerHave the host tell the controller to generate the reportGather report generated by the controller.Pick which telemetry data area to report. Default is 3 to fetch areas 1-3. Valid options are 1, 2, 3, 4.Retrieve telemetry log and write to binary filePlease provide an output file! failed to allocate buf for log Failed to open output file %s: %s! Failed to acquire telemetry header %d! Failed to flush all data to file! Data area 4 unsupported, Host Behavior Support ETDAS not set to 1 Data area 4 unsupported, bit 6 of Log Page Attributes not set Failed to acquire full telemetry log! result of the aen, use to override log idlog page offset specifies the location within a log page from where to start returning datalog specific identifier specifies an identifier that is required for a particular log pageRetrieve desired number of bytes from a given log on a specified device in either hex-dump (default) or binary formatnon-zero log-len is required param could not alloc buffer for log Device:%s log-id:%d namespace-id:%#x Get namespce ID of a the block device.optional comma-sep controller id list%s: namespace-id parameter required warning: empty controller-id list will result in no actual change in namespace attachment %s: controller id list is malformed Detach the given namespace from the given controller; de-activates the given namespace's ID. A namespace must be attached to a controller before IO commands may be directed to that namespace.Attach the given namespace to the given controller or comma-sep list of controllers. ID of the given namespace becomes active upon attachment to a controller. A namespace must be attached to a controller before IO commands may be directed to that namespace.Delete the given namespace by sending a namespace management command to the provided device. All controllers should be detached from the namespace prior to namespace deletion. A namespace ID becomes inactive when that namespace is detached or, if the namespace is not already inactive, once deleted.Formatted LBA size (FLBAS), if entering this value ignore 'block-size' fielddata protection settings (DPS)multipath and sharing capabilities (NMIC)ANA Group Identifier (ANAGRPID)target block size, specify only if 'FLBAS' value not enteredSend a namespace management command to the specified device to create a namespace with the given parameters. The next available namespace ID is used for the create operation. Note that create-ns does not attach the namespace to a controller, the attach-ns command is needed.Invalid specification of both FLBAS and Block Size, please specify only one Invalid value for block size (%lu). Block size must be a power of two FLBAS corresponding to block size %lu not found Please correct block size, or specify FLBAS directly 64-bit addr of first block to accesslimit num. media access attemptsdirective type (for write-only)directive specific (for write-only)dataset management attributes (lower 16 bits)show command instead of sendingRounding data size to fit block count (%lld bytes) Rounding metadata size to fit block count (%lld bytes) can not allocate buf for io metadata payload failed to read meta-data buffer from input file %s write: %s: failed to write buffer to output file write: %s: failed to write meta-data buffer to output file Copy from provided data buffer (default buffer is stdin) to specified logical blocks on the given device.Copy specified logical blocks on the given device to specified data buffer (default buffer is stdout).Compare specified logical blocks on device with specified data buffer; return failure if buffer and block(s) are dissimilarprefill buffers with known byte-value, default 0write/send file (default stdin)set dataflow direction to receiveset dataflow direction to sendcan not allocate metadata payload can not allocate data payload warning: write flag set but write direction bit is not set in the opcode warning: read flag set but read direction bit is not set in the opcode failed to read write buffer %s %s Command %s latency: %llu us %s Command %s is Success and result: 0x%08x Send a user-defined Admin command to the specified device via IOCTL passthrough, return results.Send a user-defined IO command to the specified device via IOCTL passthrough, return results.Retrieve FID Support and Effects log and show it.show info in readable format in case of output_format == normalReads and shows the defined NVMe controller registers in binary or human-readable formatRetrieve sanitize log and show it.Returns Reservation Status data structure describing any existing reservations on and the status of a given namespace. Namespace Reservation Status depends on the number of controllers registered for that namespace.Starting LBA(SLBA) in 64-bit address of the first logical block addressed by this commandMaximum Number of Dwords(MNDW) specifies maximum number of dwords to returnAction Type(ATYPE) specifies the mechanism the controller uses in determining the LBA Status Descriptors to return.Range Length(RL) specifies the length of the range of contiguous LBAs beginning at SLBAInformation about potentially unrecoverable LBAs.action type (--action) has to be given could not alloc memory for get lba statusRetrieve supported logs and print the table.Indicate how many DST log entries to be retrieved, by default all the 20 entries will be retrievedRetrieve the self-test log for the given device and given test (or optionally a namespace) in either decoded format (default) or binary.boot partition data output file nameRetrieve Boot Partition log page and prints it, for the given device in either decoded format(default), json or binary.could not alloc buffer for boot partition logRetrieve Reservation Notification log page and prints it, for the given device in either decoded format(default), json or binary.Retrieve Get LBA Status Info Log and prints it, for the given device in either decoded format(default),json or binary.could not alloc buffer for lba status logNumber of pending Endurance Group Event log Entries listRetrieve Retrieve Predictable Latency Event Aggregate page and prints it, for the given device in either decoded format(default), json or binary.non-zero log-entries is required param could not identify controller could not alloc buffer for endurance group event agggregate log entries endurance group event aggregate log pageaction the controller shall take during processing this persistent log page command.Retrieve Persistent Event log info for the given device in either decoded format(default), json or binary.could not alloc buffer for persistent event log header Releasing Persistent Event Log ContextEstablishing Persistent Event Log Contextcould not alloc buffer for persistent event log page Collected Persistent Event Log may be invalid, Re-read the log is reiquiredNumber of pending NVM Setlog Entries listRetrieve Predictable Latency EventAggregate Log page and prints it, for the givendevice in either decoded format(default),json or binary.could not alloc buffer for predictable latency event agggregate log entries predictable latency event gggregate log pageRetrieve Predictable latency per nvm set log page and prints it for the given device in either decoded format(default),json or binary.predictable latency per nvm setThe endurance group identifierRetrieves endurance groups log page and prints the log.Retrieve command effects log page and print the table.Retrieve specified number of error log entries from a given device in either decoded format (default) or binary.could not alloc buffer for error log Retrieve ANA log for the given device in decoded format (default), json or binary.ERROR : nvme_identify_ctrl() failed 0x%x Retrieve SMART log for the given device (or optionally a namespace) in either decoded format (default) or binary.Retrieve Changed Namespaces log for the given device in either decoded format (default) or binary.Retrieve the firmware log for the specified device in either decoded format (default) or binary.Show endurance group list information for the given endurance group idcan not allocate memory for endurance gropu list Send an Identify Domain List command to the given device, returns properties of the specified domain in either normal|json|binary format.NVMe Identify command for Domain List is successful:identifier of desired controllershow info in human readable formatSend an Identify Command Set Data command to the given device, returns properties of the specified controller in either human-readable or binary format.NVMe Identify I/O Command Set:Send an Identify UUID List command to the given device, returns list of supported Vendor Specific UUIDs in either human-readable or binary format.Send an Identify NVM Set List command to the given device, returns entries for NVM Set identifiers greater than or equal to the value specified CDW11.NVMSETID in either binary format or json formatshow descriptors in binary formatSend Namespace Identification Descriptors command to the given device, returns the namespace identification descriptors of the specific namespace in either human-readable or binary format.can not allocate controller list payload show identify in binary formatshow identify in readable formatSend an I/O Command Set Independent Identify Namespace command to the given device, returns properties of the specified namespace in human-readable or binary or json format.I/O command set independent identify namespacelowest controller identifier to displayoptional namespace attached to controllerShow secondary controller list associated with the primary controller of the given device.non-zero num-entries is required param Send an Identify Primary Controller Capabilities command to the given device and report the information in a decoded format (default), json or binary.identify primary controller capabilitiesSend an Identify Controller NVM Command Set command to the given device and report information about the specified controller in various formats.Show controller list information for the subsystem the given device is part of, or optionally controllers attached to a specific namespace.first nsid returned list should start fromshow all namespaces in the subsystem, whether attached or inactiveFor the specified controller handle, show the namespace list in the associated NVMe subsystem, optionally starting with a given nsid.Send an Identify Namespace Granularity List command to the given device, returns namespace granularity list in either human-readable or binary format.identify namespace granularitycan not allocate granularity list payload Return this namespace, even if not attaced (1.2 devices only)Send an Identify Namespace command to the given device, returns properties of the specified namespace in either human-readable or binary format. Can also return binary vendor-specific namespace attributes.Retrieve information for subsystems%s is not a NVMe namespace device Cannot read subsys NQN from %s Additional directory to search for devicesRetrieve basic information for all NVMe namespacesSend an Identify Controller command to the given device and report information about the specified controller in human-readable or binary format. May also return vendor-specific controller attributes in hex-dump if requested.Output format: normal|json|binaryThe '' may be either an NVMe character device (ex: /dev/nvme0) or an nvme block device (ex: /dev/nvme0n1).Submit a Lockdown command,return resultSubmit Feature ID Support and Effects Log, Return resultReplay Protection Memory Block commandsManage Flexible Resources between Primary and Secondary Controller Submit a Directive Send command, return resultsSubmit a Directive Receive command, return resultsDiscover and Connect to NVMeoF subsystemsShows the controller registers or properties. Requires character deviceRetrieve sanitize log, show itSubmit a verify command, return resultsSubmit a write uncorrectable command, return resultsSubmit a write zeroes command, return resultsSubmit a write command, return resultsSubmit a read command, return resultsSubmit a Compare command, return resultsSubmit a Flush command, return resultsSubmit a Simple Copy command, return resultsSubmit a Data Set Management command, return resultsSubmit a Reservation Report, return resultsSubmit a Reservation Release, return resultsSubmit a Reservation Register, return resultsSubmit a Reservation Acquire, return resultsSubmit Capacity Management Command, return resultsSubmit a Get LBA Status command, return resultsSubmit a Security Receive command, return resultsSubmit a Security Send command, return resultsSubmit an arbitrary IO command, return resultsSubmit an arbitrary admin command, return resultsVerify and commit firmware to a specific slot (fw-activate in old version < 1.2)Format namespace with new block formatGet a property and show the resulting valueSet a property and show the resulting valueSet a feature and show the resulting valueRetrieve the Supported Log pages details, show itRetrieve the SELF-TEST Log, show itPerform the necessary tests to observe the performanceGet feature and show the resulting valueRetrieve Boot Partition Log, show itRetrieve Reservation Notification Log, show itRetrieve LBA Status Information Log, show itRetrieve Endurance Group Event Aggregate Log, show itRetrieve Presistent Event Log, show itRetrieve Predictable Latency Event Aggregate Log, show itRetrieve Predictable Latency per Nvmset Log, show itRetrieve Endurance Group Log, show itRetrieve Command Effects Log, show itRetrieve Changed Namespace List, show itRetrieve FW Telemetry log write to fileGeneric NVMe get log, returns log in raw formatRetrieve the namespace ID of opened block deviceDetaches a namespace from requested controller(s)Attaches a namespace to requested controller(s)Deletes a namespace from the controllerCreates a namespace with the provided parametersSend NVMe Identify Endurance Group List, display structureSend NVMe Identify Domain List, display structureSend NVMe Identify I/O Command Set, display structureSend NVMe Identify UUID List, display structureSend NVMe Identify NVM Set List, display structureSend NVMe Namespace Descriptor List, display structureI/O Command Set Independent Identify NamespaceList Secondary Controllers associated with a Primary ControllerSend NVMe Identify Primary Controller CapabilitiesSend NVMe Identify Controller NVM Command Set, display structureSend NVMe Identify Controller List, display structureSend NVMe Identify List, display structureSend NVMe Identify Namespace Granularity List, display structureSend NVMe Identify Namespace, display structureList all NVMe devices and namespaces on machineConnect to NVMeoF subsystemofiifcprhbtscpinvalid prohibit settings:%d invalid scope settings:%d lockdowncntlidController Identifier(CNTLID)nrvirt-mgmtdir-typedirective typetarget-dirdir-specdir-operdirective operationendirdirective enablehuman-readableraw-binarytarget-dir required param invalid directive type Failed to open file %s: %s dir-sendreq-resourcenamespace stream requesteddir-receiveRescans the NVMe namespaces Namespace RescanResets the NVMe subsystem Subsystem-resetResets the NVMe controller no-deallocNo deallocate after sanitize.oipbpowpassOverwrite pass count.ausesanactSanitize action.ovrpatOverwrite pattern.Send a sanitize command.Invalid Sanitize Action SANACT is Exit Failure Mode OWPASS out of range [0-15] SANACT is not Overwrite sanitizestart-blockIONUMblock-countlimited-retrylimit media access attemptsforce-unit-accessprinfoPI and check fieldref-tagapp-tagapp tag (for end to end PI)app-tag-maskstorage-tagstorage-tag-checkinvalid 'prinfo' param:%u get-namespace-idverifyNVME Verify Successwrite uncorrectabledeacinvalid prinfo: %u write-zeroesNVME Write Zeroes SuccessflushNVMe Flush: successsdlbaslbslimited retryforce unit accessprinfowprinforexpected-ref-tagsexpected-app-tagsexpected-app-tag-masksdirective type (write part)source range entry formatinvalid range failed to allocate payload NVMe CopyNVMe Copy: successctx-attrsAttribute DeallocateidwidrNo range definition provided data-set managementNVMe DSM: successcrkeycurrent reservation keyreservation typerrelareservation release actioniekeyignore existing res. keyinvalid rrela:%d reservation releasenrkeynew reservation keyrregacptplinvalid cptpl:%d invalid rrega:%d reservation registerNVME Reservation successprkeypre-empt reservation keyracqareservation acquire actioninvalid racqa:%d reservation acquireelement-idcap-lowercap-upperinvalid operation field: %u capacity managementnssfNVMe Security Specific Fieldsecpsecurity protocol (cf. SPC-4)spspallocation length (cf. SPC-4)dump output in binary formatsecurity receiveFILEtransfer payloadtransfer length (cf. SPC-4)--tl unspecified or zero Failed to open %s: %s fstatsecurity-sendfirmware file (required)xfertransfer chunksize limitoffsetNo memory for f/w size: read :%s :%s fw-downloadFirmware download successconventionalany controllerunknown[0-7]: commit actioninvalid slot:%d invalid action:%d invalid boot partition id:%d fw-commit bpid:%d(ALL namespaces)timeout[0-2]: secure erasepil[0-1]: extended format off/onforceblock-sizetarget block sizeidentify-ctrlidentify-namespaceidentify failed invalid lbaf:%d invalid pi:%d invalid pil:%d invalid ms:%d failed to rescan namespaces offset required param get-propertythe offset of the propertyvalue required param set-propertyfeature-idfeature identifier (required)cdw12feature cdw12, if useduuid-indexspecify uuid indexsavefeature-id required param invalid uuid index param: %u self-test-codeDevice self-testfeature identifiershow feature in binary formatinvalid 'select' param:%d output-filehost-generatecontroller-initdata-areaget-telemetry-logInvalid data area requested log-ididentifier of log to retrievelog-lenhow many bytes to retrieveaenlpolsplog specific fieldlsiraeretain an asynchronous eventUUID indexcsioffset typeoutput in raw formatinvalid lsp param: %u %s: namespace-id:%d attach namespacedetach namespacenamespace to attach%s: Success, nsid:%d namespace to delete%s: Success, deleted nsid:%d delete namespacenszesize of ns (NSZE)ncapcapacity of ns (NCAP)flbasdpsnmicanagrp-idnvmset-idNVM Set Identifier (NVMSETID)command set identifier (CSI)%s: Success, created nsid:%d create namespacesize of data in bytesmetadata-sizesize of metadata in bytesmetadata filedsmshow-commandshow command before sendingdry-runlatencyoutput latency statisticsInvalid directive type, %x data size not provided can not allocate io payload opcode : %02x nsid : %02x control : %04x nblocks : %04x metadata : %lx addr : %lx slba : %lx dsmgmt : %08x reftag : %08x apptag : %04x appmask : %04x storagetagcheck : %04x storagetag : %lx latency: %s: %llu us submit-io%s: Success compareVendor SpecificAdminIOopcodeopcode (required)command flagsprefillrsvdvalue for reserved fielddata I/O length (bytes)metadata-lenmetadata seg. length (bytes)cdw2command dword 2 valuecdw3command dword 3 valuecommand dword 10 valuecommand dword 11 valuecommand dword 12 valuecdw13command dword 13 valuecdw14command dword 14 valuecdw15command dword 15 valueinput-fileprint command before sendingdata direction not given opcode : %02x flags : %02x rsvd1 : %04x nsid : %08x cdw2 : %08x cdw3 : %08x data_len : %08x metadata_len : %08x addr : %lx metadata : %lx cdw10 : %08x cdw11 : %08x cdw12 : %08x cdw13 : %08x cdw14 : %08x cdw15 : %08x timeout_ms : %08x Unknownoutput-formatFMTshow log in readable formatfid support effects logRetain an Asynchronous Eventshow log in binary formatsanitize status lognumdnumber of dwords to transferreservation reportNo memory for resv report:%d Desired Namespacestart-lbamax-dwrange-lenget lba statusverboseIncrease output verbositysupported log pagesdst-entriesself test logboot partition logData flushed into file %s resv notifi loglba status log pagelog-entriesuse binary outputnumber of bytes to retrieveinvalid action field: %u persistent event logNVM Set Identifiergroup-idendurance logeffects log pagenumber of entries to retrievedump in binary formatmallocana-log(optional) desired namespaceshow info in readable formatsmart logchanged ns list logfw logendgrp-idEndurance Group IDinvalid output format id endurance group listdom-ididentifier of desired domainNVMe Identify Domain List:NVMe Identify Domain Listcontroller-idNVMe Identify I/O Command Setshow uuid in binary formatshow uuid in readable formatidentify UUID listnvmset_idNVM Set Identify valueidentify nvm set listcntidnum-entriesid secondary controller listnvm identify controllercontroller to displayid controller listI/O command set identifierOutput format: normal|jsoninvalid nsid parameter id namespace listvendor-specificdump binary vendor fields/dev/%sCannot read nsid from %s /sys/block/%s/deviceFailed to scan namespaces DIRInvalid output format dump binary vendor field [] []fid-support-effects-logrpmbshow-hostnqnShow NVMeoF host NQNgen-hostnqnGenerate NVMeoF host NQNdisconnect-alldisconnectdiscoverDiscover NVMeoF subsystemsshow-regsns-rescanRescans the NVME namespacessubsystem-resetResets the subsystemResets the controllersanitize-logSubmit a sanitize commandwrite-uncorcopyresv-reportresv-releaseresv-registerresv-acquirecapacity-mgmtget-lba-statussecurity-recvio-passthruadmin-passthruDownload new firmwarefw-activatesupported-log-pagesself-test-logdevice-self-testboot-part-logresv-notif-loglba-status-logendurance-event-agg-logpersistent-event-logpred-lat-event-agg-logpredictable-lat-logendurance-logRetrieve Error Log, show itRetrieve ANA Log, show itsmart-logRetrieve SMART Log, show itchanged-ns-list-logfw-logRetrieve FW Log, show itget-ns-iddetach-nsattach-nsdelete-nscreate-nslist-endgrpid-domainid-iocsid-uuidid-nvmsetns-descscmdset-ind-id-nslist-secondaryprimary-ctrl-capsnvm-id-ctrllist-ctrllist-nsid-ns-granularitySend NVMe Identify Controllerlist-subsysList nvme subsystems1.16NameSpaceNSIDUsedBytesMaximumLBAPhysicalSizeSectorSizeNot SupportedYesI/O Command Set is SupportedAdmin Command Set onlyNo notification; no effectNormal shutdown notificationAbrupt shutdown notificationRound RobinTrueFalseShutdown processing occurringShutdown processing completeNot [7:1] : %#x Reserved 1.3 or later1.2.1 or earlier CSUPP+ LBCC%s NCC%s NIC%s CCC%s USS%s No command restriction Reserved CSE%-.*sfrrabieeecmicmdtsrtd3rrtd3eoaesctrattrrlscrdt1crdt2crdt3nvmsrvwcimecoacsaclaerlfrmwlpaelpenpssavsccapstawctempcctempmtfahmprehmmintnvmcapunvmcaprpmbsedsttdstofwugkashctmamntmtmxtmtsanicaphmmindshmmaxdnsetidmaxanattanacapanagrpmaxnanagrpiddomainidmegcapsqescqesmaxcmdnnoncsfusesfnavwcicsvsccnwpcocfssglsmaxdnamaxcnasubnqnioccsziorcszicdofffcattmsdbdofcspsdsmax_powerentry_latexit_latread_tputread_latwrite_tputwrite_latidle_poweridle_scaleactive_poweractive_work_scaleUnknown FeatureOperating System Driver NamePre-boot Controller NamePre-boot Driver NamePre-boot Driver VersionUnknown Controller TypePre-boot Namespace NameUnknown Namespace Type Element[%-3d]: Type : 0x%02x (%s) Revision : %d Length : %d Value : %s , %6.2f %2sB / %6.2f %2sB%3.0f %2sB + %2d Bng%dn%d%-12s %-16s %-8d %-26s %-16s %01u.%04uW%01u.%02uWreserved%s : Not Reported %s : %u Delete I/O Submission QueueCreate I/O Submission QueueGet Log PageDelete I/O Completion QueueCreate I/O Completion QueueIdentifyAbortSet FeaturesGet FeaturesAsynchronous Event RequestNamespace ManagementFirmware CommitFirmware Image DownloadDevice Self-testNamespace AttachmentKeep AliveDirective SendDirective ReceiveVirtualization ManagementNVMEe-MI SendNVMEe-MI ReceiveDoorbell Buffer ConfigFormat NVMSecurity SendSecurity ReceiveSanitizeGet LBA Status%-*.*sDevicePathIndexModelNumberpcieProductNameSerialNumberWrite ZeroesDataset ManagementReservation RegisterReservation ReportReservation AcquireReservation ReleaseVerifyCompareFlushWrite Uncorrectableevent_typedtwin_reads_typicaldtwin_writes_typicaldtwin_time_maximumndwin_time_minimum_highndwin_time_minimum_lowdtwin_reads_estimatedtwin_writes_estimatedtwin_time_estimateEvent Type: %u DTWIN Reads Typical: %lu DTWIN Writes Typical: %lu DTWIN Time Maximum: %lu NDWIN Time Minimum Low: %lu DTWIN Reads Estimate: %lu DTWIN Writes Estimate: %lu DTWIN Time Estimate: %lu num_entries_availentrylist_of_entriesEntry[%d]: %u Firmware Commit Event(0x2)Timestamp Change Event(0x3)Power-on or Reset Event(0x4)Change Namespace Event(0x6)Format NVM Start Event(0x7)Sanitize Start Event(0x9)Set Feature Event(0xb)Set Telemetry CRT Event(0xc)Thermal Excursion Event(0xd)log_idtotal_num_of_eventstotal_log_lenlog_revisionlog_header_lentimestamppower_on_hourspower_cycle_countpci_vidpci_ssvidgen_numberrcibitmap_%xSupport %slist_of_event_entriesevent_numberevent_type_revevent_header_lenctrl_idevent_time_stampvu_info_lenevent_lencritical_warningavail_sparespare_threshpercent_useddata_units_readdata_units_writtenhost_read_commandshost_write_commandscontroller_busy_timepower_cyclesunsafe_shutdownsmedia_errorsnum_err_log_entrieswarning_temp_timecritical_comp_timetemperature_sensor_%dthm_temp1_trans_countthm_temp2_trans_countthm_temp1_total_timethm_temp2_total_time%lu (%s)old_fw_revnew_fw_revfw_commit_actionfw_slotsct_fwsc_fwvu_assign_fw_commit_rcprev_tsml_secs_since_resetfw_actop_in_progctrl_power_cyclepower_on_ml_secsctrl_time_stampnss_hw_err_codensmgt_cdw10nscapana_grp_idformat_nvm_cdw10smallest_fpiformat_nvm_statuscompln_infostatus_fieldSANICAPsani_cdw10sani_cdw11sani_progsani_statuscmpln_infoover_templslplennlslneestulblsgcneidnlrdratyperslbarnlbns_elementsRecommended Action Type: %u RSLBA[%d]: %lu RNLB[%d]: %u Empty Log PageRegistration PreemptedReservation ReleasedReservation Preemptedrn_log_typenum_logsLog Page Count : %lx Namespace ID: : %x abpidbpszLog ID: %u Boot Partition Size: %u KiB Active BPID: %u fid_%ufid_supportAdmin Command Set FSUPP+ UDCC%s NAMESPACE SCOPE%s CONTROLLER SCOPE%s NVM SET SCOPE%s ENDURANCE GROUP SCOPE%s DOMAIN SCOPE%s NVM Subsystem SCOPE%sTransportAddressANAStatePathsSubsystems%s - NQN=%s \ +- %s %s %s %s %s 64 KB1 MB16 MB256 MB64 GBNot supported NOT minutes500 millisecondsNormal OperationRestore ErrorUnreliableREADYNot ReadySHALLMAYOne KBOne MBOne GBvsintmsintmcnssraqaasqacqcmbloccmbszbpinfobprselbpmblcmbmsccmbstspmrcappmrctlpmrstspmrebspmrswtppmrmsclpmrmscucap : %lx version : %x NVMe specification %d.%d cc : %x csts : %x nssr : %x intms : %x intmc : %x aqa : %x asq : %lx acq : %lx cmbloc : %x cmbsz : %x bpinfo : %x bprsel : %x bpmbl : %lx cmbmsc : %lx cmbsts : %x pmrcap : %x pmrctl : %x Enable (EN): PMR is %s pmrsts : %x pmrebs : %x pmrswtp : %x pmrmscl : %#x pmrmscu : %#x Disabled/sys/class/nvme/%snvme%dc%dn%d%snvme%dn%dnvme-print.cwidth < sizeof(ascii)%3x %04x: %02x %*s "%.*s" [31:24]: %#x Access Size [23:16]: %#x Total Size [15:6] : %#x Reserved Never NAWUN, NAWUPF, and NACWUAWUN, AWUPF, and ACWUat End of Data LBAin Separate Contiguous BufferFirstLastType 3 EnabledType 2 EnabledType 1 EnabledReserved EnabledCRC of The Value Read0xFFFF0xFF0x00Not ReportedReserved ValueGoodDegradedBestBetternusensfeatnlbafdpcrescapnawunnawupfnacwunabsnnabonabspfnoiobnsattrnvmsetidnpwgnpwanpdgnpdanowsmssrlmclmsrcendgideui64nguidlbafsNVME Identify Namespace %d: nsze : %#lx ncap : %#lx nuse : %#lx nsfeat : %#x [7:5] : %#x Reserved nlbaf : %d flbas : %#x mc : %#x [7:2] : %#x Reserved dpc : %#x dps : %#x [7:4] : %#x Reserved nmic : %#x rescap : %#x fpi : %#x dlfeat : %d nawun : %d nawupf : %d nacwu : %d nabsn : %d nabo : %d nabspf : %d noiob : %d nvmcap : %.0Lf npwg : %u npwa : %u npdg : %u npda : %u nows : %u mssrl : %u mcl : %d msrc : %u anagrpid: %u nsattr : %u nvmsetid: %d endgid : %d nguid : eui64 : vs[]:does not nstat [2:0] : %#x Reserved nstat : %#x %#xnidtnidluuid : %s csi : %#x SR-IOVPCIMultiSingle-Only/WriteNVMeAllStaticDynamicNotNVME Identify Controller:vid : %#x ssvid : %#x sn : %-.*s mn : %-.*s fr : %-.*s rab : %d ieee : %02x%02x%02x cmic : %#x [2:2] : %#x %s [1:1] : %#x %s Controller [0:0] : %#x %s Port mdts : %d cntlid : %#x ver : %#x rtd3r : %#x rtd3e : %#x oaes : %#x [30:28] : %#x Reserved [26:16] : %#x Reserved [10:10] : %#x Reserved [7:0] : %#x Reserved ctratt : %#x [31:16] : %#x Reserved [8:8] : %#x Reserved [6:6] : %#x Reserved rrls : %#x cntrltype : %d [1:0] : %#x %s fguid : %-.*s crdt1 : %u crdt2 : %u crdt3 : %u nvmsr : %u vwci : %u mec : %u oacs : %#x [15:11] : %#x Reserved acl : %d aerl : %d frmw : %#x [7:6] : %#x Reserved lpa : %#x [7:7] : %#x Reserved elpe : %d npss : %d avscc : %#x apsta : %#x wctemp : %d cctemp : %d mtfa : %d hmpre : %d hmmin : %d tnvmcap : %.0Lf unvmcap : %.0Lf rpmbs : %#x edstt : %d dsto : %d fwug : %d kas : %d hctma : %#x mntmt : %d mxtmt : %d sanicap : %#x [31:30] : %#x %s [28:3] : %#x Reserved hmminds : %d hmmaxd : %d nsetidmax : %d endgidmax : %d anatt : %d anacap : %d [5:5] : %#x Reserved anagrpmax : %d nanagrpid : %d pels : %d domainid : %d megcap : %.0Lf sqes : %#x cqes : %#x maxcmd : %d nn : %d oncs : %#x [15:9] : %#x Reserved fuses : %#x fna : %#x vwc : %#x [7:3] : %#x Reserved [2:1] : %#x %s awun : %d awupf : %d icsvscc : %d nwpc : %d acwu : %d ocfs : %#x [15:2] : %#x Reserved sgls : %#x [31:22]: %#x Reserved [1:0] : %#x Reserved mnan : %d maxdna : %.0Lf maxcna : %d subnqn : %-.*s ioccsz : %d iorcsz : %d icdoff : %d fcatt : %#x msdbd : %d ofcs : %d [15:1] : %#x Reserved ps %4d : mp:%01u.%04uW %01u.%02uW non- active_power:vslwzslwusldmrldmrsldmslNVMe Identify Controller NVM:vsl : %u wzsl : %u wusl : %u dmrl : %u dmrsl : %u dmsl : %lu zaslNVMe ZNS Identify Controller:zasl : %u zocozcsmarmorrrlfrlrrl1rrl2rrl3frl1frl2frl3lbafezszezdesYes (Host support required) (in use)zoc : %u ozcs : %u mar : %#x mor : %#x mor : %u Open Resources rrl frl vs[] :nsid_list[%4u]:%#x NVMe Changed Zone List:nrzid: %u zid %03d: %lu EMPTYIMP_OPENEDEXP_OPENEDCLOSEDREADONLYFULLOFFLINEUnknown StateSEQWRITE_REQnr_zoneszone_listwpext_dataNot validExtension Data: num_ctrlctrl_listnum of ctrls present: %u NVMSetendurance_group_idrandom_4k_read_typicaloptimal_write_sizetotal_nvmset_capunalloc_nvmset_capnid : %d nvmset_id : %d endurance_group_id : %d random_4k_read_typical : %u optimal_write_size : %u portidcrtvqfrtvqrfavqrfapvqprtvqfrsmvqgranvifrtvirfavirfapviprtvifrsmvigranportid : %#x crt : %#x vqfrt : %d vqrfa : %d vqrfap : %d vqprt : %d vqfrsm : %d vqgran : %d vifrt : %d virfa : %d virfap : %d viprt : %d vifrsm : %d vigran : %d secondary-controllersprimary-controller-identifiersecondary-controller-statevirtual-function-numbernum-virtual-queuesnum-virtual-interrupts SCEntry[%-3d]: attributesnum-descriptorsnamespace-size-granularitynamespace-granularity-list Entry[%2d] : No association reportedassociated with PCI Vendor IDassociationUUID-listNVME Identify UUID: Entry[%3d] association : 0x%x %s UUID : %s (Invalid UUID) .................iocs_list [63:3] : %lx Reserved3 num_dom_entriesdomain_listdom_idunalloc_dom_capmax_egrp_dom_capNumber of Domain Entires: %u num_endgrp_idendgrp_listgenregctlptplsregctlsrcstsregctlext NVME Reservation status: gen : %d rtype : %d regctl : %d ptpls : %d regctl[%d] : cntlid : %x rcsts : %x hostid : %lx rkey : %lx regctlext[%d] : cntlid : %x rcsts : %x rkey : %lx hostid : Active Firmware Slot (afi)Firmware Rev Slot %dFirmware Log for device:%s afi : %#x frs%d : %s Changed Namespace List Log[%4u]more than %d ns changed ACS_%u (%s)admin_cmd_setIOCS_%u (%s)io_cmd_setACS%-6d[%-32s] %08x NVM Command SetIOCS%-5d[%-32s] %08xSupported Log PagesError InformationSMART InformationFirmware Slot InformationChanged Namespace ListTelemetry Host-InitiatedEndurance Group InformationAsymmetric Namespace AccessPersistent Event LogLBA Status InformationBoot PartitionFID Supported and EffectsDiscoveryReservation NotificationSanitize StatusHost Identifierlid_0x%x supported_logsLID 0x%x (%s), supports 0x%x LSUPP is %s IOS is %s avl_spareavl_spare_thresholdendurance_estimatemediate_write_commandshost_read_cmdshost_write_cmdsmedia_data_integrity_errnum_err_info_log_entriescritical warning : %u avl_spare : %u avl_spare_threshold : %u percent_used : %u%% endurance_estimate : %'.0Lf data_units_read : %'.0Lf data_units_written : %'.0Lf media_units_written : %'.0Lf host_read_cmds : %'.0Lf host_write_cmds : %'.0Lf available_sparetemp_thresholdreliability_degradedvmbu_failedpmr_rocritical_warning : %#x available_spare : %u%% percentage_used : %u%% data_units_read : %'.0Lf power_cycles : %'.0Lf power_on_hours : %'.0Lf unsafe_shutdowns : %'.0Lf media_errors : %'.0Lf non-optimizedinaccessiblepersistent-losschangeinvalid statechgcntngrpsnnsidsNSIDSANA DESC LIST ANA LOG HEADER :-chgcnt : %lu ngrps : %u ANA Log Desc :-grpid : %u nnsids : %u state : %s nsid : %u Sanitize in Progress. (No time period reported)sprogglobal_erasedno_cmplted_passes(%d) %ssstatcdw10_infotime_over_writetime_block_erasetime_crypto_erasetime_over_write_no_dealloctime_block_erase_no_dealloctime_crypto_erase_no_dealloc (%f%%) [2:0] %s [7:3] %s: %u [8] %s: %u%s ArbitrationPower ManagementLBA Range TypeError RecoveryVolatile Write CacheNumber of QueuesInterrupt CoalescingWrite Atomicity NormalAsync Event ConfigurationHost Memory BufferKeep Alive TimerRead Recovery LevelI/O Command Set ProfileSoftware ProgressReservation Notification MaskReservation PersistenceTimestampNamespce Write ProtectHost BehaviorMI Controller MetadataMI Namespace MetadataSpinup ControlController CapabilitiesInterrupt Vector Mask SetInterrupt Vector Mask ClearController ConfigurationController StatusNVM Subsystem ResetAdmin Queue AttributesController Memory Buffer Sizecap : %lx cc : %x csts : %x nssr : %x CurrentDefaultSavedSupported capabilities Feature is saveable Feature is per-namespace Feature is changeableNVMe status: %s(%#x) RDMA Transport error.TCP Transport error.Intra-host Transport error.sqidcmdidphase_tagparm_error_locationtrtypetrtype_spec_info Entry[%2d] error_count : %lu sqid : %d cmdid : %#x status_field : %#x(%s) phase_tag : %#x parm_err_loc : %#x lba : %#lx nsid : %#x vs : %d trtype : %s cs : %#lx trtype_spec_info: %#x List of Valid ReportsSelf test resultSelf test codeSegment numberValid Diagnostic InformationPower on hoursNamespace IdentifierFailing LBAStatus Code TypeStatus CodeCurrent operation : %#x Current Completion : %u%% Self Test Result[%d]: Vendor specificFilesystemRAIDPage / Swap fileLBA range may be overwritten type : %#x - %s attributes : %#x - %s, %s slba : %#lx nlb : %#lx guid : enableddisabled Directive support Identify Directive : %s Stream Directive : %s Directive status Open Stream Count : %u Stream Identifier %.6u : %u No WorkloadHeavy Sequential WritesOver Temperature ThresholdUnder Temperature ThresholdTemperature Sensor 1Temperature Sensor 2Temperature Sensor 3Temperature Sensor 4Temperature Sensor 5Temperature Sensor 6Temperature Sensor 7Temperature Sensor 8Send async eventDo not send async eventDeterministic Window (DTWIN)No Write ProtectPermanent Write Protect Feature Identifier ReservedNo limit Workload Hint (WH): %u - %s Power State (PS): %u Coalescing Disable (CD): %s Interrupt Vector (IV): %u Disable Normal (DN): %s Auto PST Entries ................. Entry[%2d] Enable Event :%04x DTWIN Reads Threshold :%lu DTWIN Writes Threshold:%lu DTWIN Time Threshold :%lu Window Select: %s%c %Z The timestamp is : %lu (%s) truefalseDoes not already existNVM subsystem portPCIe Correctable ErrorPCIe Link Status ChangePCIe Link Not ActiveCritical Warning ConditionUnsafe ShutdownController Fatal StatusLog Identifier: %u Total Number of Events: %u Total Log Length : %lu Log Revision: %u Log Header Length: %u Power On Hours (POH): %'.0Lf Power Cycle Count: %lu PCI Vendor ID (VID): %u Serial Number (SN): %-.*s Model Number (MN): %-.*s Generation Number: %u [31:19] : %#x Reserved Supported Events Bitmap: Support %s Persistent Event Entries:Event Number: %u Event Type: %s Event Type Revision: %u Event Header Length: %u Controller Identifier: %u Event Timestamp: %lu Event Length: %u Smart Health Event Entry: FW Commit Event Entry: FW Commit Action: %u FW Slot: %u Previous Timestamp: %lu Power On Reset Event Entry: Firmware Revision: %lu (%s) Reset Information List: Controller ID: %u Firmware Activation: %u Operation in Progress: %u Controller Power Cycle: %u Power on milliseconds: %lu Controller Timestamp: %lu Namespace Size: %lu Namespace Capacity: %lu Formatted LBA Size: %u ANA Group Identifier: %u NVM Set Identifier: %u Namespace ID: %u Namespace Identifier: %u Format NVM Attributes: %u Format NVM CDW10: %u Format NVM Status: %u Completion Information: %u Status Field: %u Sanitize Start Event Entry: SANICAP: %u Sanitize CDW10: %u Sanitize CDW11: %u Sanitize Progress: %u Sanitize Status: %u Set Feature Event Entry: Over Temperature: %u Threshold: %u Reserved Event DevicesSubsystemSubsystemNQNControllersHostNQNHostIDNamespacesNVM Express Subsystems Subsystem-NQN%-16s %-96s %-.16s %-.16s %-.96s %-.16s NVM Express Controllers FRMNTxPort%-16s %-96s NVM Express Namespaces UsageGenericModelNodeFW RevOfflineOnlineController type not reportedI/O ControllerDiscovery ControllerAdministrative ControllerNot EnforcedOnly Admin Command Set Supported Controller Memory Buffer Supported (CMBS): The Controller Memory Buffer is %s Persistent Memory Region Supported (PMRS): The Persistent Memory Region is %s Memory Page Size Maximum (MPSMAX): %u bytes Memory Page Size Minimum (MPSMIN): %u bytes Boot Partition Support (BPS): %s Command Sets Supported (CSS): NVM command set is %s One or more I/O Command Sets are %s %s NVM Subsystem Reset Supported (NSSRS): %s Doorbell Stride (DSTRD): %u bytes Timeout (TO): %u ms Arbitration Mechanism Supported (AMS): Weighted Round Robin with Urgent Priority Class is %s Contiguous Queues Required (CQR): %s Maximum Queue Entries Supported (MQES): %u All supported I/O Command Sets I/O Completion Queue Entry Size (IOCQES): %u bytes I/O Submission Queue Entry Size (IOSQES): %u bytes Shutdown Notification (SHN): Arbitration Mechanism Selected (AMS): Weighted Round Robin with Urgent Priority Class Memory Page Size (MPS): %u bytes I/O Command Set Selected (CSS): %s Enable (EN): %s Processing Paused (PP): %s NVM Subsystem Reset Occurred (NSSRO): %s Shutdown Status (SHST): Normal operation (no shutdown has been requested) Controller Fatal Status (CFS): %s Ready (RDY): %s [0:0] : %#x Namespace Multipath %sCapable [7:7] : %#x Ignore Existing Key - Used as defined in revision %s [6:6] : %#x Exclusive Access - All Registrants %sSupported [5:5] : %#x Write Exclusive - All Registrants %sSupported [4:4] : %#x Exclusive Access - Registrants Only %sSupported [3:3] : %#x Write Exclusive - Registrants Only %sSupported [2:2] : %#x Exclusive Access %sSupported [1:1] : %#x Write Exclusive %sSupported [0:0] : %#x Persist Through Power Loss %sSupported [6:0] : %#x Format Progress Indicator (Remaining %d%%) [7:7] : %#x Format Progress Indicator %sSupported No other command for same namespace No other command for any namespaceOperating System Controller NameOperating System Driver VersionOperating System Namespace Name Num Metadata Element Descriptors: %d %-21s %-*.*s %-*.*s %-9d %-26s %-16s %-.*s Predictable Latency Per NVM Set Log for device: %s Predictable Latency Per NVM Set Log for NVM Set ID: %u NDWIN Time Minimum High: %lu Predictable Latency Event Aggregate Log for device: %s Number of Entries Available: %lu SMART/Health Log Snapshot Event(0x1)NVM Subsystem Hardware Error Event(0x5)Format NVM Completion Event(0x8)Sanitize Completion Event(0xa)No log data can be shown with this log len at least 512 bytes is required or can be 0 to read the complete log page after context establishedendurance_grp_critical_warning_summaryEndurance Group Event Aggregate Log for device: %s Number of LBA Range Descriptors (NLRD) set to %#x for NS element %dLBA Status Log for device: %s LBA Status Log Page Length: %u Number of LBA Status Log Namespace Elements: %u Estimate of Unrecoverable Logical Blocks: %u LBA Status Generation Counter: %u Namespace Element Identifier: %u Number of LBA Range Descriptors: %u Number of LBA Range Descriptors (NLRD) set to %#x for NS element %d Reservation Notif Log for device: %s Resv Notif Log Page Type : %u (%s) Num of Available Log Pages : %u Boot Partition Log for device: %s FID Supports Effects Log for device: %s FID %02x -> Support Effects Log: %08x NVM Subsystem Reset Control (NSSRC): %u Interrupt Vector Mask Set (IVMS): %x Interrupt Vector Mask Clear (IVMC): %x Admin Completion Queue Size (ACQS): %u Admin Submission Queue Size (ASQS): %u Admin Submission Queue Base (ASQB): %lx Admin Completion Queue Base (ACQB): %lx Controller Memory Buffer feature is not supported Offset (OFST): 0x%x (See cmbsz.szu for granularity) CMB Queue Dword Alignment (CQDA): %d CMB Data Metadata Mixed Memory Support (CDMMMS): %s CMB Data Pointer and Command Independent Locations Support (CDPCILS): %s CMB Data Pointer Mixed Locations Support (CDPMLS): %s CMB Queue Physically Discontiguous Support (CQPDS): %s CMB Queue Mixed Memory Support (CQMMS): %s Base Indicator Register (BIR): 0x%x Size (SZ): %u Size Units (SZU): %s Write Data Support (WDS): Write Data and metadata transfer in Controller Memory Buffer is %s Read Data Support (RDS): Read Data and metadata transfer in Controller Memory Buffer is %s PRP SGL List Support (LISTS): PRP/SG Lists in Controller Memory Buffer is %s Completion Queue Support (CQS): Admin and I/O Completion Queues in Controller Memory Buffer is %s Submission Queue Support (SQS): Admin and I/O Submission Queues in Controller Memory Buffer is %s Active Boot Partition ID (ABPID): %u Boot Read Status (BRS): No Boot Partition read operation requestedBoot Partition read in progressBoot Partition read completed successfullyError completing Boot Partition read Boot Partition Size (BPSZ): %u Boot Partition Identifier (BPID): %u Boot Partition Read Offset (BPROF): %x Boot Partition Read Size (BPRSZ): %x Boot Partition Memory Buffer Base Address (BMBBA): %lx Controller Base Address (CBA): %lx Controller Memory Space Enable (CMSE): %lx Capabilities Registers Enabled (CRE): CMBLOC and CMBSZ registers are%senabled Controller Base Address Invalid (CBAI): %x Controller Memory Space Supported (CMSS): Referencing PMR with host supplied addresses is %s Persistent Memory Region Timeout (PMRTO): %x Persistent Memory Region Write Barrier Mechanisms (PMRWBM): %x Persistent Memory Region Time Units (PMRTU): PMR time unit is %s Base Indicator Register (BIR): %x Write Data Support (WDS): Write data to the PMR is %s Read Data Support (RDS): Read data from the PMR is %s Controller Base Address Invalid (CBAI): %x Health Status (HSTS): %s Not Ready (NRDY): The Persistent Memory Region is %s to process PCI Express memory read and write requests Error (ERR): %x PMR Elasticity Buffer Size Base (PMRWBZ): %x Read Bypass Behavior : memory reads not conflicting with memory writes in the PMR Elasticity Buffer %s bypass those memory writes PMR Elasticity Buffer Size Units (PMRSZU): %s PMR Sustained Write Throughput (PMRSWTV): %x PMR Sustained Write Throughput Units (PMRSWTU): %s/second Controller Base Address (CBA): %#x Controller Memory Space Enable (CMSE): %#x Namespace %s has parent controller(s):Controller %s has child namespace(s): [5:3] : %#x Authentication Method [2:0] : %#x Number of RPMB Units [4:4] : %#x NPWG, NPWA, NPDG, NPDA, and NOWS are %sSupported [3:3] : %#x NGUID and EUI64 fields if non-zero, %sReused [2:2] : %#x Deallocated or Unwritten Logical Block error %sSupported [1:1] : %#x Namespace uses %s [0:0] : %#x Thin Provisioning %sSupported [4:4] : %#x Metadata Transferred %s [3:0] : %#x Current LBA Format Selected [1:1] : %#x Metadata Pointer %sSupported [0:0] : %#x Metadata as Part of Extended Data LBA %sSupported [4:4] : %#x Protection Information Transferred as Last 8 Bytes of Metadata %sSupported [3:3] : %#x Protection Information Transferred as First 8 Bytes of Metadata %sSupported [2:2] : %#x Protection Information Type 3 %sSupported [1:1] : %#x Protection Information Type 2 %sSupported [0:0] : %#x Protection Information Type 1 %sSupported [3:3] : %#x Protection Information is Transferred as %s 8 Bytes of Metadata [2:0] : %#x Protection Information %s [4:4] : %#x Guard Field of Deallocated Logical Blocks is set to %s [3:3] : %#x Deallocate Bit in the Write Zeroes Command is %sSupported [2:0] : %#x Bytes Read From a Deallocated Logical Block and its Metadata are %s LBA Format %2d : Metadata Size: %-3d bytes - Data Size: %-2d bytes - Relative Performance: %#x %s %s lbaf %2d : ms:%-3d lbads:%-2d rp:%#x %s NVME Identify Command Set Idependent Namespace %d: [4:4] : %#x Namespace %sstore data on rotational media [0:0] : %#x Name space is %sready NVME Namespace Identification Descriptors NS %d: [3:3] : %#x ANA %ssupported [31:31] : %#x Discovery Log Change Notice %sSupported [27:27] : %#x Zone Descriptor Changed Notices %sSupported [15:15] : %#x Normal NSS Shutdown Event %sSupported [14:14] : %#x Endurance Group Event Aggregate Log Page Change Notice %sSupported [13:13] : %#x LBA Status Information Notices %sSupported [12:12] : %#x Predictable Latency Event Aggregate Log Change Notices %sSupported [11:11] : %#x Asymmetric Namespace Access Change Notices %sSupported [9:9] : %#x Firmware Activation Notices %sSupported [8:8] : %#x Namespace Attribute Changed Event %sSupported [15:15] : %#x Extended LBA Formats %sSupported [14:14] : %#x Delete NVM Set %sSupported [13:13] : %#x Delete Endurance Group %sSupported [12:12] : %#x Variable Capacity Management %sSupported [11:11] : %#x Fixed Capacity Management %sSupported [10:10] : %#x Multi Domain Subsystem %sSupported [9:9] : %#x UUID List %sSupported [7:7] : %#x Namespace Granularity %sSupported [5:5] : %#x Predictable Latency Mode %sSupported [4:4] : %#x Endurance Groups %sSupported [3:3] : %#x Read Recovery Levels %sSupported [2:2] : %#x NVM Sets %sSupported [1:1] : %#x Non-Operational Power State Permissive %sSupported [0:0] : %#x 128-bit Host Identifier %sSupported [1:1] : %#x NVM subsystem %spart of an Enclosure [0:0] : %#x NVM subsystem %spart of an Storage Device [7:7] : %#x VPD Write Cycles Remaining field is %svalid. [6:0] : %#x VPD Write Cycles Remaining [1:1] : %#x NVM subsystem %scontains a Management Endpoint on a PCIe port [0:0] : %#x NVM subsystem %scontains a Management Endpoint on an SMBus/I2C port [10:10] : %#x Lockdown Command and Feature %sSupported [9:9] : %#x Get LBA Status Capability %sSupported [8:8] : %#x Doorbell Buffer Config %sSupported [7:7] : %#x Virtualization Management %sSupported [6:6] : %#x NVMe-MI Send and Receive %sSupported [5:5] : %#x Directives %sSupported [4:4] : %#x Device Self-test %sSupported [3:3] : %#x NS Management and Attachment %sSupported [2:2] : %#x FW Commit and Download %sSupported [1:1] : %#x Format NVM %sSupported [0:0] : %#x Security Send and Receive %sSupported [5:5] : %#x Multiple FW or Boot Update Detection %sSupported [4:4] : %#x Firmware Activate Without Reset %sSupported [3:1] : %#x Number of Firmware Slots [0:0] : %#x Firmware Slot 1 Read%s [6:6] : %#x Telemetry Log Data Area 4 %sSupported [5:5] : %#x LID 0x0, Scope of each command in LID 0x5, 0x12, 0x13 %sSupported [4:4] : %#x Persistent Event log %sSupported [3:3] : %#x Telemetry host/controller initiated log page %sSupported [2:2] : %#x Extended data for Get Log Page %sSupported [1:1] : %#x Command Effects Log Page %sSupported [0:0] : %#x SMART/Health Log Page per NS %sSupported [0:0] : %#x Admin Vendor Specific Commands uses %s Format [0:0] : %#x Autonomous Power State Transitions %sSupported [16:0] : %ld C (%u Kelvin) Warning temperature (WCTEMP) [16:0] : %ld C (%u Kelvin) Critical temperature (CCTEMP) [0:0] : %#x Host Controlled Thermal Management %sSupported [29:29] : %#x No-Deallocate After Sanitize bit in Sanitize command %sSupported [2:2] : %#x Overwrite Sanitize Operation %sSupported [1:1] : %#x Block Erase Sanitize Operation %sSupported [0:0] : %#x Crypto Erase Sanitize Operation %sSupported [7:7] : %#x Non-zero group ID %sSupported [6:6] : %#x Group ID does %schange [4:4] : %#x ANA Change state %sSupported [3:3] : %#x ANA Persistent Loss state %sSupported [2:2] : %#x ANA Inaccessible state %sSupported [1:1] : %#x ANA Non-optimized state %sSupported [0:0] : %#x ANA Optimized state %sSupported [7:4] : %#x Max SQ Entry Size (%d) [3:0] : %#x Min SQ Entry Size (%d) [7:4] : %#x Max CQ Entry Size (%d) [3:0] : %#x Min CQ Entry Size (%d) [8:8] : %#x Copy %sSupported [7:7] : %#x Verify %sSupported [6:6] : %#x Timestamp %sSupported [5:5] : %#x Reservations %sSupported [4:4] : %#x Save and Select %sSupported [3:3] : %#x Write Zeroes %sSupported [2:2] : %#x Data Set Management %sSupported [1:1] : %#x Write Uncorrectable %sSupported [0:0] : %#x Compare %sSupported [0:0] : %#x Fused Compare and Write %sSupported [3:3] : %#x FormatNVM Broadcast NSID (FFFFFFFFh) %sSupported [2:2] : %#x Crypto Erase %sSupported as part of Secure Erase [1:1] : %#x Crypto Erase Applies to %s Namespace(s) [0:0] : %#x Format Applies to %s Namespace(s) [0:0] : %#x Volatile Write Cache %sPresent [0:0] : %#x NVM Vendor Specific Commands uses %s Format [2:2] : %#x Permanent Write Protect %sSupported [1:1] : %#x Write Protect Until Power Supply %sSupported [0:0] : %#x No Write Protect and Write Protect Namespace %sSupported [1:1] : %#x Controller Copy Format 1h %sSupported [0:0] : %#x Controller Copy Format 0h %sSupported [17:17]: %#x Byte-Aligned Contig. MD Buffer %sSupported [16:16]: %#x SGL Bit-Bucket %sSupported [15:8] : %#x SGL Descriptor Threshold [2:2] : %#x Keyed SGL Data Block descriptor %sSupported [1:0] : %#x Scatter-Gather Lists Supported. Dword alignment required. [1:0] : %#x Scatter-Gather Lists Supported. No Dword alignment required. [1:0] : %#x Scatter-Gather Lists Not Supported [0:0] : %#x %s Controller Model [0:0] : %#x Disconnect command %s Supported operational enlat:%d exlat:%d rrt:%d rrl:%d rwt:%d rwl:%d idle_power: [18:18]: %#x SGL Length Larger than Buffer %sSupported [19:19]: %#x Metadata Pointer Containing SGL Descriptor is %sSupported [20:20]: %#x Address Offsets %sSupported [21:21]: %#x Transport SGL Data Block Descriptor %sSupported ZNS Command Set Identify Namespace:zoc : %u Zone Operation Characteristics [1:1] : %#x Zone Active Excursions: %s [0:0] : %#x Variable Zone Capacity: %s ozcs : %u Optional Zoned Command Support [0:0] : %#x Read Across Zone Boundaries: %s mar : No Active Resource Limitmar : %u Active Resources mor : No Open Resource LimitLBA Format Extension %2d : Zone Size: 0x%lx LBAs - Zone Descriptor Extension Size: %-1d bytes%s lbafe %2d: zsze:0x%lx zdes:%u%s Too many zones have changed to fit into the log. Use report zones for changes.SLBA: %#-10lx WP: %#-10lx Cap: %#-10lx State: %-12s Type: %-14s Attrs: Zone Descriptor Extension is %sVaild Reset Zone Recommended with Reset Recommended Limit%s Finish Zone Recommended with Finish Recommended Limit%s Zone Finished by ControllerSLBA: %#-10lx WP: %#-10lx Cap: %#-10lx State: %#-4x Type: %#-4x Attrs: %#-4x AttrsInfo: %#-4x NVME Identify NVM Set List %d: NVM Set Attribute Entry[%2d] total_nvmset_cap : %.0Lf unalloc_nvmset_cap : %.0Lf NVME Identify Primary Controller Capabilities: [1:1] %#x VI Resources are %ssupported [0:0] %#x VQ Resources are %ssupported secondary-controller-identifierIdentify Secondary Controller List: NUMID : Number of Identifiers : %d SCID : Secondary Controller Identifier : 0x%.04x PCID : Primary Controller Identifier : 0x%.04x SCS : Secondary Controller State : 0x%.04x (%s) VFN : Virtual Function Number : 0x%.04x NVQ : Num VQ Flex Resources Assigned : 0x%.04x NVI : Num VI Flex Resources Assigned : 0x%.04x namespace-capacity-granularityIdentify Namespace Granularity List: ATTR : Namespace Granularity Attributes: 0x%x NUMD : Number of Descriptors : %d NSG : Namespace Size Granularity : 0x%lx NCG : Namespace Capacity Granularity : 0x%lx associated with PCI Subsystem Vendor IDI/O Command Set Combination[%u]: %lx [2:2] : %#x ZNS Command Set %sSelected [1:1] : %#x KV Command Set %sSelected [0:0] : %#x NVM Command Set %sSelected Domain Id for Attr Entry[%u]: %u Domain Capacity for Attr Entry[%u]: %.0Lf\nUnallocated Domain Capacity for Attr Entry[%u]: %.0Lf Max Endurange Group Domain Capacity for Attr Entry[%u]: %.0Lf num of endurance group ids: %u Commands Supported and EffectsTelemetry Controller-InitiatedPredictable Latency Per NVM SetPredictable Latency Event AggregateEndurance Group Event AggregateSupport Log Pages Deatils for %s: Establish Context and Read 512 Bytes of Header is %s Endurance Group Log for NVME device:%s Group ID:%x media_data_integrity_err: %'.0Lf num_err_info_log_entries: %'.0Lf Smart Log for NVME device:%s namespace-id:%x Available Spare[0] : %d Temp. Threshold[1] : %d NVM subsystem Reliability[2] : %d Read-only[3] : %d Volatile mem. backup failed[4] : %d Persistent Mem. RO[5] : %d temperature : %ld C (%u Kelvin) available_spare_threshold : %u%% endurance group critical warning summary: %#x data_units_written : %'.0Lf host_read_commands : %'.0Lf host_write_commands : %'.0Lf controller_busy_time : %'.0Lf num_err_log_entries : %'.0Lf Warning Temperature Time : %u Critical Composite Temperature Time : %u Temperature Sensor %d : %ld C (%u Kelvin) Thermal Management T1 Trans Count : %u Thermal Management T2 Trans Count : %u Thermal Management T1 Total Time : %u Thermal Management T2 Total Time : %u Asymmetric Namespace Access Log for NVMe deviceAsymmetric Namespace Access Log for NVMe device: %s NVM Subsystem has never been sanitized.Most Recent Sanitize Command Completed Successfully.Most Recent Sanitize Command Failed.Most Recent Sanitize Command (No-Deallocate After Sanitize) Completed Successfully.Global Data Erased set: no NS LB in the NVM subsystem has been written to and no PMR in the NVM subsystem has been enabledGlobal Data Erased cleared: a NS LB in the NVM subsystem has been written to or a PMR in the NVM subsystem has been enabledSanitize Progress (SPROG) : %uSanitize Status (SSTAT) : %#x Number of completed passes if most recent operation was overwriteSanitize Command Dword 10 Information (SCDW10) : %#x Estimated Time For Overwrite Estimated Time For Block Erase Estimated Time For Crypto Erase Estimated Time For Overwrite (No-Deallocate) Estimated Time For Block Erase (No-Deallocate) Estimated Time For Crypto Erase (No-Deallocate)Interrupt Vector ConfigurationAutonomous Power State TransitionNon-Operational Power State ConfigPredicatable Latency Mode ConfigPredicatable Latency Mode WindowLBA Status Infomation AttributesEnduarance Event Group ConfigurationHost Controlled Thermal ManagementAdmin Submission Queue Base AddressAdmin Completion Queue Base AddressController Memory Buffer Locationproperty: 0x%02x (%s), value: %x unknown property: 0x%02x (%s), value: %lx SUCCESS: The command completed successfullyINVALID_OPCODE: The associated command opcode field is not validINVALID_FIELD: A reserved coded value or an unsupported value in a defined fieldCMDID_CONFLICT: The command identifier is already in useDATA_XFER_ERROR: Error while trying to transfer the data or metadataPOWER_LOSS: Command aborted due to power loss notificationINTERNAL: The command was not completed successfully due to an internal errorABORT_REQ: The command was aborted due to a Command Abort requestABORT_QUEUE: The command was aborted due to a Delete I/O Submission Queue requestFUSED_FAIL: The command was aborted due to the other command in a fused operation failingFUSED_MISSING: The command was aborted due to a Missing Fused CommandINVALID_NS: The namespace or the format of that namespace is invalidCMD_SEQ_ERROR: The command was aborted due to a protocol violation in a multicommand sequenceSGL_INVALID_LAST: The command includes an invalid SGL Last Segment or SGL Segment descriptor.SGL_INVALID_COUNT: There is an SGL Last Segment descriptor or an SGL Segment descriptor in a location other than the last descriptor of a segment based on the length indicated.SGL_INVALID_DATA: This may occur if the length of a Data SGL is too short.SGL_INVALID_METADATA: This may occur if the length of a Metadata SGL is too shortSGL_INVALID_TYPE: The type of an SGL Descriptor is a type that is not supported by the controller.CMB_INVALID_USE: The attempted use of the Controller Memory Buffer is not supported by the controller.PRP_INVALID_OFFSET: The Offset field for a PRP entry is invalid.ATOMIC_WRITE_UNIT_EXCEEDED: The length specified exceeds the atomic write unit size.OPERATION_DENIED: The command was denied due to lack of access rights.SGL_INVALID_OFFSET: The offset specified in a descriptor is invalid.INCONSISTENT_HOST_ID: The NVM subsystem detected the simultaneous use of 64-bit and 128-bit Host Identifier values on different controllers.KEEP_ALIVE_EXPIRED: The Keep Alive Timer expired.KEEP_ALIVE_INVALID: The Keep Alive Timeout value specified is invalid.PREEMPT_ABORT: The command was aborted due to a Reservation Acquire command with the Reservation Acquire Action (RACQA) set to 010b (Preempt and Abort).SANITIZE_FAILED: The most recent sanitize operation failed and no recovery actions has been successfully completedSANITIZE_IN_PROGRESS: The requested function is prohibited while a sanitize operation is in progressNVME_SC_SGL_DATA_BLK_GRAN_INVALID: Address alignment or Length granularity for an SGL Data Block descriptor is invalidNVME_SC_CMD_NOT_SUP_QUEUE_IN_CMB: does not support submission of the command to a SQ or completion to a CQ in the CMBIOCS_NOT_SUPPORTED: The I/O command set is not supportedIOCS_NOT_ENABLED: The I/O command set is not enabledIOCS_COMBINATION_REJECTED: The I/O command set combination is rejectedINVALID_IOCS: the I/O command set is invalidNVME_SC_ID_UNAVAILABLE: The number of Endurance Groups or NVM Sets supported has been exceeded.LBA_RANGE: The command references a LBA that exceeds the size of the namespaceNS_WRITE_PROTECTED: The command is prohibited while the namespace is write protected by the host.TRANSIENT_TRANSPORT: A transient transport error was detected.NVME_SC_PROHIBITED_BY_CMD_AND_FEAT: command was aborted due to execution being prohibited by the Command and Feature LockdownNVME_SC_ADMIN_CMD_MEDIA_NOT_READY: Admin command requires access to media and the media is not readyCAP_EXCEEDED: The execution of the command has caused the capacity of the namespace to be exceededNS_NOT_READY: The namespace is not ready to be accessed as a result of a condition other than a condition that is reported as an Asymmetric Namespace Access conditionRESERVATION_CONFLICT: The command was aborted due to a conflict with a reservation held on the accessed namespaceFORMAT_IN_PROGRESS: A Format NVM command is in progress on the namespace.ZONE_BOUNDARY_ERROR: Invalid Zone Boundary crossingZONE_IS_FULL: The accessed zone is in ZSF:Full stateZONE_IS_READ_ONLY: The accessed zone is in ZSRO:Read Only stateZONE_IS_OFFLINE: The access zone is in ZSO:Offline stateZONE_INVALID_WRITE: The write to zone was not at the write pointer offsetTOO_MANY_ACTIVE_ZONES: The controller does not allow additional active zonesTOO_MANY_OPEN_ZONES: The controller does not allow additional open zonesINVALID_ZONE_STATE_TRANSITION: The zone state change was invalidCQ_INVALID: The Completion Queue identifier specified in the command does not existQID_INVALID: The creation of the I/O Completion Queue failed due to an invalid queue identifier specified as part of the command. An invalid queue identifier is one that is currently in use or one that is outside the range supported by the controllerQUEUE_SIZE: The host attempted to create an I/O Completion Queue with an invalid number of entriesABORT_LIMIT: The number of concurrently outstanding Abort commands has exceeded the limit indicated in the Identify Controller data structureABORT_MISSING: The abort command is missingASYNC_LIMIT: The number of concurrently outstanding Asynchronous Event Request commands has been exceededFIRMWARE_SLOT: The firmware slot indicated is invalid or read only. This error is indicated if the firmware slot exceeds the number supportedFIRMWARE_IMAGE: The firmware image specified for activation is invalid and not loaded by the controllerINVALID_VECTOR: The creation of the I/O Completion Queue failed due to an invalid interrupt vector specified as part of the commandINVALID_LOG_PAGE: The log page indicated is invalid. This error condition is also returned if a reserved log page is requestedINVALID_FORMAT: The LBA Format specified is not supported. This may be due to various conditionsFW_NEEDS_CONVENTIONAL_RESET: The firmware commit was successful, however, activation of the firmware image requires a conventional resetINVALID_QUEUE: This error indicates that it is invalid to delete the I/O Completion Queue specified. The typical reason for this error condition is that there is an associated I/O Submission Queue that has not been deleted.FEATURE_NOT_SAVEABLE: The Feature Identifier specified does not support a saveable valueFEATURE_NOT_CHANGEABLE: The Feature Identifier is not able to be changedFEATURE_NOT_PER_NS: The Feature Identifier specified is not namespace specific. The Feature Identifier settings apply across all namespacesFW_NEEDS_SUBSYSTEM_RESET: The firmware commit was successful, however, activation of the firmware image requires an NVM SubsystemFW_NEEDS_RESET: The firmware commit was successful; however, the image specified does not support being activated without a resetFW_NEEDS_MAX_TIME_VIOLATION: The image specified if activated immediately would exceed the Maximum Time for Firmware Activation (MTFA) value reported in Identify Controller. To activate the firmware, the Firmware Commit command needs to be re-issued and the image activated using a resetFW_ACTIVATION_PROHIBITED: The image specified is being prohibited from activation by the controller for vendor specific reasonsOVERLAPPING_RANGE: This error is indicated if the firmware image has overlapping rangesNS_INSUFFICIENT_CAPACITY: Creating the namespace requires more free space than is currently available. The Command Specific Information field of the Error Information Log specifies the total amount of NVM capacity required to create the namespace in bytesNS_ID_UNAVAILABLE: The number of namespaces supported has been exceededNS_ALREADY_ATTACHED: The controller is already attached to the namespace specifiedNS_IS_PRIVATE: The namespace is private and is already attached to one controllerNS_NOT_ATTACHED: The request to detach the controller could not be completed because the controller is not attached to the namespaceTHIN_PROVISIONING_NOT_SUPPORTED: Thin provisioning is not supported by the controllerCONTROLLER_LIST_INVALID: The controller list provided is invalidDEVICE_SELF_TEST_IN_PROGRESS: The controller or NVM subsystem already has a device self-test operation in process.BOOT PARTITION WRITE PROHIBITED: The command is trying to modify a Boot Partition while it is lockedINVALID_CTRL_ID: An invalid Controller Identifier was specified.INVALID_SECONDARY_CTRL_STATE: The action requested for the secondary controller is invalid based on the current state of the secondary controller and its primary controller.INVALID_NUM_CTRL_RESOURCE: The specified number of Flexible Resources is invalidINVALID_RESOURCE_ID: At least one of the specified resource identifiers was invalidANA_INVALID_GROUP_ID: The specified ANA Group Identifier (ANAGRPID) is not supported in the submitted command.ANA_ATTACH_FAIL: The controller is not attached to the namespace as a result of an ANA conditionNVME_SC_INSUFFICIENT_CAP: Requested operation requires more free space than is currently availableNVME_SC_NS_ATTACHMENT_LIMIT_EXCEEDED: Attaching the ns to a controller causes max number of ns attachments allowed to be exceededNVME_SC_PROHIBIT_CMD_EXEC_NOT_SUPPORTED: Prohibition of Command Execution Not SupportedBAD_ATTRIBUTES: Bad attributes were givenINVALID_PROTECION_INFO: The Protection Information Field settings specified in the command are invalidWRITE_ATTEMPT_READ_ONLY_RANGE: The LBA range specified contains read-only blocksCMD_SIZE_LIMIT_EXCEEDED: Command size limit exceededWRITE_FAULT: The write data could not be committed to the mediaREAD_ERROR: The read data could not be recovered from the mediaGUARD_CHECK: The command was aborted due to an end-to-end guard check failureAPPTAG_CHECK: The command was aborted due to an end-to-end application tag check failureREFTAG_CHECK: The command was aborted due to an end-to-end reference tag check failureCOMPARE_FAILED: The command failed due to a miscompare during a Compare commandACCESS_DENIED: Access to the namespace and/or LBA range is denied due to lack of access rightsUNWRITTEN_BLOCK: The command failed due to an attempt to read from an LBA range containing a deallocated or unwritten logical blockNVME_SC_STORAGE_TAG_CHECK: command was aborted due to an end-to-end storage tag check failureINTERNAL_PATH_ERROT: The command was not completed as the result of a controller internal errorASYMMETRIC_NAMESPACE_ACCESS_PERSISTENT_LOSS: The requested function (e.g., command) is not able to be performed as a result of the relationship between the controller and the namespace being in the ANA Persistent Loss stateASYMMETRIC_NAMESPACE_ACCESS_INACCESSIBLE: The requested function (e.g., command) is not able to be performed as a result of the relationship between the controller and the namespace being in the ANA Inaccessible stateASYMMETRIC_NAMESPACE_ACCESS_TRANSITION: The requested function (e.g., command) is not able to be performed as a result of the relationship between the controller and the namespace transitioning between Asymmetric Namespace Access statesCONTROLLER_PATHING_ERROR: A pathing error was detected by the controllerHOST_PATHING_ERROR: A pathing error was detected by the hostHOST_COMMAND_ABORT: The command was aborted as a result of host actionCMD_INTERRUPTED: Command processing was interrupted and the controller is unable to successfully complete the command. The host should retry the command.Sanitize Prohibited While Persistent Memory Region is Enabled: A sanitize operation is prohibited while the Persistent Memory Region is enabled.The transport type is not indicated or the error is not transport related.Fibre Channel Transport error.Error Log Entries for device:%s entries:%d Entry not used (does not contain a result)Current Device Self-Test OperationCurrent Device Self-Test CompletionDevice Self Test Log for NVME device:%s Operation Result : %#x Short device self-test operation Extended device self-test operation Segment Number : %#x Valid Diagnostic Information : %#x Power on hours (POH) : %#lx Namespace Identifier : %#x Failing LBA : %#lx Status Code Type : %#x Status Code : %#x Vendor Specific : %#x %#x Self Test Code : %xLBA range should be hidden from the OS/EFI/BIOSLBA range should be visible from the OS/EFI/BIOSLBA range should not be overwrittendir-receive: type:%#x operation:%#x spec:%#x nsid:%#x result:%#x Max Streams Limit (MSL): %u NVM Subsystem Streams Available (NSSA): %u NVM Subsystem Streams Open (NSSO): %u NVM Subsystem Stream Capability (NSSC): %u Stream Write Size (in unit of LB size) (SWS): %u Stream Granularity Size (in unit of SWS) (SGS): %u Namespece Streams Allocated (NSA): %u Namespace Streams Open (NSO): %u Namespace Streams Allocated (NSA): %u LBA Status Information Poll Interval (LSIPI) : %u LBA Status Information Report Interval (LSIRI): %u Extended Idle Period with a Burst of Random WritesNon-deterministic Window (NDWIN)Write Protect Until Power CycleThe Timestamp field was initialized with a Timestamp value using a Set Features command.The Timestamp field was initialized to ‘0’ by a Controller Level Reset.The controller may have stopped counting during vendor specific intervals after the Timestamp value was initializedThe controller counted time in milliseconds continuously since the Timestamp value was initialized. High Priority Weight (HPW): %u Medium Priority Weight (MPW): %u Low Priority Weight (LPW): %u Arbitration Burst (AB): Number of LBA Ranges (NUM): %u Threshold Type Select (THSEL): %u - %s Threshold Temperature Select (TMPSEL): %u - %s Temperature Threshold (TMPTH): %ld C (%u Kelvin) Deallocated or Unwritten Logical Block Error Enable (DULBE): %s Time Limited Error Recovery (TLER): %u ms Volatile Write Cache Enable (WCE): %s Number of IO Completion Queues Allocated (NCQA): %u Number of IO Submission Queues Allocated (NSQA): %u Aggregation Time (TIME): %u usec Aggregation Threshold (THR): %u Zone Descriptor Changed Notices: %s Discovery Log Page Change Notices: %s Endurance Group Event Aggregate Log Change Notices: %s LBA Status Information Notices : %s Predictable Latency Event Aggregate Log Change Notices: %s Asymmetric Namespace Access Change Notices: %s Telemetry Log Notices : %s Firmware Activation Notices : %s Namespace Attribute Notices : %s SMART / Health Critical Warnings: %s Autonomous Power State Transition Enable (APSTE): %s Idle Time Prior to Transition (ITPT): %u ms Idle Transition Power State (ITPS): %u Enable Host Memory (EHM): %s Host Memory Descriptor List Entry Count (HMDLEC): %u Host Memory Descriptor List Address (HMDLAU): 0x%x Host Memory Descriptor List Address (HMDLAL): 0x%x Host Memory Buffer Size (HSIZE): %u Pre-boot Software Load Count (PBSLC): %u Predictable Latency Window Enabled: %s Endurance Group Identifier (ENDGID): %u Endurance Group Critical Warnings : %u I/O Command Set Comination Index(IOCSCI): %u Host Identifier (HOSTID): %lu Mask Reservation Preempted Notification (RESPRE): %s Mask Reservation Released Notification (RESREL): %s Mask Registration Preempted Notification (REGPRE): %s Persist Through Power Loss (PTPL): %s Namespace Write Protect state: %s Thermal Management Temperature 1 (TMT1) : %u Kelvin (%ld C) Thermal Management Temperature 2 (TMT2) : %u Kelvin (%ld C) Keep Alive Timeout (KATO) in milliseconds: %u Non-Operational Power State Permissive Mode Enable (NOPPME): %s Host Behavior Support Advanced Command Retry Enable (ACRE): %s Host Behavior Support Extended Telemetry Data Area 4 Supported (ETDAS): %s Host Behavior Support LBA Format Extension Enable (LBAFEE): %s No-Deallocate Response Mode (NODRM) : %u Read Recovery Level (RRL): %u Spinup control feature Enabled: %s PCIe Uncorrectable Non fatal ErrorPCIe Uncorrectable Fatal ErrorEndurance Group Critical Warning ConditionMedia and Data Integrity StatusPersistent Event Log for device: %s Action for Persistent Event Log: %u PCI Subsystem Vendor ID (SSVID): %u NVM Subsystem NVMe Qualified Name (SUBNQN): %-.*s Reporting Context Information (RCI): %u Reporting Context Exists (RCE): %s(%u) Reporting Context Port Identifier Type (RCPIT): %u(%s) Reporting Context Port Identifier (RCPID): %#x Vendor Specific Information Length: %u Old Firmware Revision: %lu (%s) New Firmware Revision: %lu (%s) Status Code Type for Firmware Commit Command: %u Status Returned for Firmware Commit Command: %u Vendor Assigned Firmware Commit Result Code: %u Time Stamp Change Event Entry: Milliseconds Since Reset: %lu NVM Subsystem Hardware Error Event Code Entry: %u, %s Change Namespace Event Entry: Namespace Management CDW10: %u End-to-end Data Protection Type Settings: %u Namespace Multi-path I/O and Namespace Sharing Capabilities: %u Format NVM Start Event Entry: Format NVM Completion Event Entry: Smallest Format Progress Indicator: %u Sanitize Completion Event Entry: Set Feature ID :%#02x (%s), value:%#08x Thermal Excursion Event Entry: Number of LBA Status Descriptors(NLSD): %u Completion Condition(CMPC): %u Completed due to transferring the amount of data specified in the MNDW field Completed due to having performed the action specified in the Action Type field over the number of logical blocks specified in the Range Length field{ DSLBA: 0x%016lu, NLB: 0x%08x, Status: 0x%02x } %-8s %-20s %-40s %-8s %-6s %-14s %-12s %-16s %-.8s %-.20s %-.40s %-.8s %-.6s %-.14s %-.12s %-.16s %-12s %-12s %-8s %-26s %-16s %-16s %-.12s %-.12s %-.8s %-.26s %-.16s %-.16s %-8s %-.20s %-.40s %-.8s %-6s %-14s %-12s %-21s %-20s %-40s %-9s %-26s %-16s %-8s %-.21s %-.20s %-.40s %-.9s %-.26s %-.16s %-.8s Operation completed without errorOperation was aborted by a Device Self-test commandOperation was aborted by a Controller Level ResetOperation was aborted due to a removal of a namespace from the namespace inventoryOperation was aborted due to the processing of a Format NVM commandA fatal error or unknown test error occurred while the controller was executing the device self-test operation and the operation did not completeOperation completed with a segment that failed and the segment that failed is not knownOperation completed with one or more failed segments and the first segment that failed is indicated in the SegmentNumber fieldOperation was aborted for unknown reasonOperation was aborted due to a sanitize operationSupport for the NSID field set to FFFFFFFFh is not indicatedThe Flush command does not support NSID set to FFFFFFFFhThe Flush command supports NSID set to FFFFFFFFhAdditional media modification after sanitize operation completes successfully is not definedMedia is not additionally modified after sanitize operation completes successfullyMedia is additionally modified after sanitize operation completes successfullygpggggggooooooootodoTooDo4ooo$ooooonoonnnonnnooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooonoootndnTnoDno4nHrXrhrsxrrssrrssrrrssrsssrsss@rPxwwwwwwwwxx x0x@xx}8}xPHH~~x}x}8~sg[O D 4$DDDDDDDD 455555555t5d5T5D545$5566566466666666666666666666666666666666666666666666666666666666666666666666666666666666666666666646666666666666664466666666666666666666666666666666666666666666666666666666666664I$IIIIIIIIIIIIIIIOLJCL7L+LOLOLOLOLOLOLOLOLOLOLLPHQlQ`QTQM(QQQPQS|SlS\SLSCmalloc: %s Error: requesting reset on non-controller handle Operation successfulGeneral failureAuthentication (MAC) failureUnknown error%s ! Expired write-counter ! %s ! %s %s failed with error = 0x%x memory alloc failed for %s ./%sab+socketbindsetsockoptacceptcallocmd5hmac(sha256)LockedUnlockedmsgfilekeyfilemsgtargetprogram-keyread-counterread-datawrite-configread-configFailed to read key Failed to read file %s Write Counter is: %u failed read config blk Boot Parition 1 is %s Boot Parition 0 is %s read_request failed Writting %d bytes to file %s invalid transfer size %d Failed to write-dataFailed to Program Keyinvalid transfer size %d Failed to read data from file %s with %s No memory for reading file :%s Counter failure (not matching/incrementing failure)Address failure (out of range or wrong alignment)Write (data/counter/result) failureRead (data/counter/result) failureAuthentication key not yet programmedInvalid device configuration block%s ! non-matching response 0x%04x for 0x%04x RPMB request 0x%04x to target 0x%xerror 0x%x receiving response for %s Failed to write %s data to %s Failed to open %s file to write %s Memory allocation failed for request 0x%04x failed to allocate RPMB config buffer RPMB action - info, program-key, read-counter, write-data, read-data, write-config and read-configdata file for read/write-data, read/write-config optionskey file that has authentication key to be usedkey to be used for authenticationdata to be written on write-data or write-config commandsSector offset to read from or write to for an RPMB target, default 0Number of 512 blocks to read or writeRPMB target - numerical value of 0 to 6, default 0Run RPMB command on the supporting controllerNo RPMB targets are supported by the drive Invalid option %s for rpmb command Invalid key size %d, valid input 1 to 223 Boot Parition Protection is %s Saving received config data to %s file Failed to allocated memory for read-data req Failed to read write counter for write-data Memory alloc failed for write-data command failed to compute HMAC-SHA256 RPMB request 0x%04x for 0x%x, error: %d Write-data read result 0x%x, error = 0x%x Auth data write recv error = 0x%x Written %d sectors out of %d @target(%d):0x%x failed to allocate rpmb request buffer failed to read config block write counter failed to compute hmac-sha256 hash Write-config RPMB request, error = 0x%x failed to allocate response buffer memory Failed getting write-config response error = 0x%x Failed to retrieve write-config responsefailed to allocate request buffer memory <Ƨ<<Failed to open LightNVM mgmt interfaceDevice has already been initialized.LightNVM (%u,%u,%u). %u target type(s) registered. Creation of target failed. Please see dmesg. Remove of target failed. Please see dmesg. invalid identify geometry returned Generic/Enable opcodes as found in this spec. Reserved/Reserved for future opcode configurations [0]: Bad block table management [1]: Hybrid command support [0]: Hybrid mode (L2P MAP is in device) [1]: Error Code Correction(ECC) mode Single bit Level Cell flash (SLC) Two bit Level Cell flash (MLC) Three bit Level Cell flash (TLC) [0]: Single plane read [1]: Dual plane read [2]: Quad plane read [8]: Single plane program [9]: Dual plane program [10]: Quad plane program [16]: Single plane erase [17]: Dual plane erase [18]: Quad plane erase [1]: Command suspension [0]: Vector copy support [1]: Multiple resets supportTotal chunks in namespace: %d Get bad block table not supported on version %d Out of bound channel id or LUN id Use raw output to retrieve table.Set bad block table not supported on version %d Out of bound channel id, LUN id, plane id, orblock id Initialization failed.Unknown error occurred (%d) Number of devices: %u Block manager%-12s %-12s Version %-12s %-12s (%u,%u,%u) Type Version%s (%u,%u,%u) Factory reset failed. verid : %#x vmnt : %#x ppaf : ch offs : %d ch bits : %d lun offs: %d lun bits : %d pl offs : %d pl bits : %d blk offs: %d blk bits : %d pg offs : %d pg bits : %d sec offs: %d sec bits : %d mtype : %d NAND Flash Memory Reserved chnls : %d luns : %d plns : %d blks : %d pgs : %d fpg_sz : %d csecs : %d sos : %d trdt : %d trdm : %d tprt : %d tprm : %d tbet : %d tbem : %d mpos : %#x [0]: SLC mode [2]: Scramble [3]: Encryption cpar : %#x ver_major : %#x ver_minor : %#x mccap : %#x wit : %d lba format grp len : %d pu len : %d chk len : %d clba len : %d geometry num_grp : %d num_pu : %d num_chk : %d clba : %d write req ws_min : %d ws_opt : %d mw_cunits : %d maxoc : %d maxocpu : %d perf metrics trdt (ns) : %d trdm (ns) : %d twrt (ns) : %d twrm (ns) : %d tcrst (ns) : %d tcrsm (ns) : %d Version %d not supported. NVMe Status:%s(%x) NSID:%d mccap : %#x fmtype : %d dom : %#x cgrps : %d cap : %#x FREEOPENUNKNOWNRANDWRITE_ALLOWEDDEVIATEDNONEnvme_get_log13 [%5d] { SLBA: 0x%016lx, WP: 0x%016lx, CNLB: 0x%016lx, State: %-8s, Type: %-20s, Attr: %-8s, WLI: %4d } LightNVM Bad Block Stats:tblks : %d tfact : %d tgrown : %d tdresv : %d thresv : %d /dev/lightnvm/co/etc/nvme/hostnqn,%s,%s=%dnone,%s=%sunrecognizedtcp80094420rdmafailed to get traddr for %s /dev/nvme-fabricsFailed to write to %s: %s Failed to read from %s: %s /sys/class/nvme%s/%stransportnvme_get_ctrl_attr failed katono memory for ctrl name %s loopneed a address (-a) argument host_traddrhost_ifacetrsvcid/etc/nvme/hostidnr_io_queuesnr_write_queuesnr_poll_queuesqueue_sizekeep_alive_tmoreconnect_delayctrl_loss_tmofast_io_fail_tmotosduplicate_connectdisable_sqflowhdr_digestdata_digest%s/nvme%d/dev/nvme%dfailed to open %s: %s failed to write to %s: %s Discovery log is saved to %s genctrrecordsadrfamsubtypetreqrdma_prtyperdma_qptyperdma_cmsrdma_pkeysectypePersistent device: nvme%d trtype: %s adrfam: %s subtype: %s treq: %s portid: %d trsvcid: %.*s subnqn: %s traddr: %.*s rdma_prtype: %s rdma_qptype: %s rdma_cms: %s rdma_pkey: 0x%04x sectype: %s Discovery retries exhausted. ,hostnqn=%s,hostid=%s,queue_size=%d,nr_io_queues=%d,nr_write_queues=%d,nr_poll_queues=%d,host_traddr=%s,host_iface=%s,reconnect_delay=%d,ctrl_loss_tmo=%d,fast_io_fail_tmo=%d,tos=%d,keep_alive_tmo=%d,transport=%s,traddr=%.*s,trsvcid=%.*sskipping unsupported adrfam transport typetransport addresshost-traddrhost-ifaceraw output filekeep-alive-tmoreconnect-delayctrl-loss-tmotype of servicenr-io-queuesnr-write-queuesnr-poll-queuesqueue-sizepersistentquietmatching/etc/nvme/discovery.conffailed to strdup args = nqn nameuser-defined hostnqnduplicate-connectdisable-sqflowhdr-digestdata-digestneed a -n argument nvme deviceneed a -n or -d argument %s/%s/subsysnqn%s/%s/delete_controllerrdma-cmconnecteddatagramnot specifiedinfinibandroceroce-v2iwarpnot requireddiscovery subsystemnvme subsystempciipv4ipv6fibre-channelinstance=%dcntlid=%dnqn.2014-08.org.nvmexpress:uuid:%sfailed to resolve host %s info unrecognized address family (%d) %s Failed to parse ctrl info for "%s" nqn.2014-08.org.nvmexpress.discoveryno NVMe controller(s) detected. /sys/class/nvme/nvme%d/delete_controllerneed a transport (-t) argument could not alloc memory for discovery log headercould not alloc memory for discovery log pagetraddr=%.*s is already connected Discovery Log Number of Records %d, Generation counter %lu =====Discovery Log Entry %d====== Get number of discovery log entries failed. Get discovery log entries failed. No discovery log entries to fetch. Numrec values of last two get discovery log page not equal Get discovery log page failed: %d skipping unsupported subtype %d skipping unsupported transport %d transport service id (e.g. IP port)host traddr (e.g. FC WWN's or IP source address)host transport interface (e.g. IP eth1, enp2s0)user-defined hostnqn (if default not used)user-defined hostid (if default not used)existing discovery controller devicekeep alive timeout period in secondsreconnect timeout period in secondscontroller loss timeout period in secondsfast I/O fail timeout (default off)enable transport protocol header digest (TCP transport)enable transport protocol data digest (TCP transport)number of io queues to use (default is core count)number of write queues to use (default 0)number of poll queues to use (default 0)number of io queue elements to use (default 128)persistent discovery connectionsuppress already connected errorsconnect only records matching the traddrNo discover params given and no %s failed to allocate argv vector: %m allow duplicate connections between same transport host and subsystem portdisable controller sq flow control (default false)NQN:%s disconnected %d controller(s) Failed to disconnect by NQN: %s Failed to disconnect by device name: %s not specified, sq flow control disable supported(H,disable_sqflowFailed to open %s with errno %s /sys/class/nvme/nvme%d/device/subsystem_vendor/sys/class/nvme/nvme%d/device/subsystem_device/sys/class/nvme/nvme%d/device/vendor/sys/class/nvme/nvme%d/device/device/sys/class/nvme/nvme%d/device/class/usr/share/hwdata/pci.ids/usr/share/pci.ids/usr/share/misc/pci.idsPCI_IDS_PATHCould not find pci.ids file # C class%s: %s %s %s%s: %s %s%s: %s Device %s%s: Vendor %s Device %sNULLUnknown Deviceusage: %s %s %s usage: %s %s %s-%s %-*s %s Shows the program versionDisplay this help%s %s %s [OPTIONS]%s-%s-%sman%s %s version %s The following are all implemented sub-commands:See '%s %s help ' for more information on a specific command See '%s help ' for more information on a specific command The following are all installed plugin extensions: See '%s help' for more information on a plugin ERROR: Invalid sub-command '%s' for plugin %s ERROR: Invalid sub-command '%s' Uo zzUUUr_sb  Ts y snvme%dnnvme-subsysnvme-subsys%dnvme%dn%dp%dFailed to read %s: %s /sys/class/nvme-subsystem//dev/%s/%s/ana_state%s/%s/nsid%s is not an nvme device /sys/block/nvme%dn%d/queuelogical_block_size%s failed to map. /sys/firmware/dmi/entries%s/%s/type%s/%s/rawFailed to read ANA state from %s %s is not a physical nvme controller /sys/class/nvme/%s/device/resource0/sys/class/misc/%s/device/resource0%s did not find a pci resource, open failed %s Did your kernel enable CONFIG_IO_STRICT_DEVMEM? %02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02xIntel Marketing Name Log: %s latstatsvaluesEnable LSTdisableDisable LSTEnable latency trackingUnsupported command _s%4.2f%sclsnlwwwmic_blmic_fwss : %d health : %s cls : %d nlw : %d scap : %d sstat : %d bl : %s ww : %s mic_bl : %s mic_fw : %s program_fail_counterase_fail_countwear_leveling_counte2e_error_detect_countcrc_error_countmedia_wear_percentagetimed_work_loadthermal_throttle_statusretry_buff_overflow_countpll_lock_loss_counternand_bytes_writtenhost_bytes_writtenhost_context_wear_usedperformance_status_indicatormedia_bytes_readavailable_fw_downgradesre-allocated_sector_countsoft_ecc_error_rateunexpected_power_lossInvalid IDDump output in binary formatDump output in json formatIntel Smart logavgwear_levelingtimed_workload_media_weartimed_workload_host_readstimed_workload_timerpctretry_buffer_overflow_countpll_lock_loss_counthost_ctx_wear_usedperf_stat_indicatorre_alloc_sectr_cntsoft_ecc_err_rateunexp_power_lossavail_fw_downgradesDevice statswrite failureNlogEventLogAssertLogregionnlognumNamespace to get logs fromverbose-nlog%s_%-.*s.binintel logSuccessfully wrote log to %s bucketstart%-*d%-*s%-*lu %-*d value in usUnsupported revision (%u.%u) EndStartBucket%-12s%-12s%-12s%-20s intel1.16temp-statssmart-log-addmarket-namelat-stats-trackingset-bucket-thresholdslat-statsGet Temperature Statistics log and show it. Intel Temperature Statistics--------------------------------Current temperature : %lu Last critical overtemp flag : %lu Life critical overtemp flag : %lu Highest temperature : %lu Lowest temperature : %lu Max operating temperature : %lu Min operating temperature : %lu Estimated offset : %lu Get Intel Marketing Name log and show it.Enable/Disable Intel Latency Statistics Tracking. No argument prints current status.Cannot enable and disable simultaneously.Latency Statistics Tracking (FID 0x%X) is currently (%i). Could not read feature id 0xE2.Command failed while parsing. Successfully set enable bit for FID (0x%X) to %i. Set write bucket Thresholds for latency tracking (read default)Bucket Threshold List, comma separated list: 0, 10, 20 ...Write Intel Bucket Thresholds for Latency Statistics TrackingQuerying media version failed. NVMe Status:%s(%x) ERROR: Bucket list is malformed %02X%02X%02X%02X%02X%02X%02X%02XGet Intel vendor specific additional smart log (optionally, for the specified namespace), and show it.end_to_end_error_detection_countAdditional Smart Log for NVME device:%s namespace-id:%x ID KEY Normalized Raw%#x %-45s %3d %lu failed on cmd.data_len %u cmd.cdw13 %u cmd.cdw12 %x cmd.cdw10 %u err %x remaining size %d Log type: 0, 1, or 2 for nlog, event log, and assert log, respectively.Select which region log should come from. -1 for allSelect which nlog to read. -1 for all nlogsOutput file; defaults to device name providedTo print out verbose nlog infoGet Intel Firmware Log and save it.Log major:%d minor:%d header:%d size:%d Log major:%d minor:%d header:%d size:%d numcores:%d Version Major %u Version Minor %u Log_select %u totalnlogs %u nlognum %u nlogname %u nlogbytesze %u nlogprimarybuffsize %u tickspersecond %u corecount %u nlogpausestatus %u selectoffsetref %u selectnlogpause %u selectaddedoffset %u nlogbufnum %u nlogbufnummax %u coreselected %u Get write statistics (read default)Get Intel Latency Statistics log and show it.Quering thresholds failed. NVMe Status:%s(%x) Unsupported minor revision (%u.%u) Average latency since last resetIntel IO %s Command Latency Statistics Major Revision : %u Minor Revision : %u Average latency since last reset: %lu us Intel vendor specific extensionsRetrieve Intel Temperature Statistics log, show itRetrieve Intel SMART Log, show itRetrieve Intel Marketing Name log, show itEnable and disable Latency Statistics logging.Set Latency Stats Bucket Values, save itRetrieve Intel IO Latency Statistics log, show itRetrieve Intel internal firmware log, save it$tI?zD_:?bdevbdev : %s amznAmazon vendor specific extensionschannel-idchannel identifierlun-idplane-idblock-idshow infos in binary formatdevice-nameDEVICEerase-only-markedclear-host-side-blksclear-bb-blksdevice name missing target-nameTARGETtarget-typeTARGETTYPElun-beginlun-endover-provfactoryCreate target in factory modetarget name missing target type missing gennvmmediamgr-nameMMOutput format: normal|binaryshow infos in readable formatlnvmLightNVM specific extensionsdiag-set-bbtblUpdate bad block tablediag-bbtblDiagnose bad block tableReset device to factory stateremoveRemove target from devicecreatechunk-logChunk Information Log Pagelun identifier (within a channel)plane identifier (within a lun)block identifier (within a plane)value to update the specific block to.Update bad block table on a LightNVM compatible device.Updating: Ch.: %u LUN: %u Plane: %u Block: %u -> %u Receive bad block table from a LightNVM compatible device.identifier of desired device. e.g. nvme0n1.only erase marked blocks. default: all blocks.remove host side blocks list. default: keep.remove grown bad blocks list. default: keepFactory initialize a LightNVM enabled device.target name of the device to initialize. e.g. target0.identifier of target type. e.g. pblk.Define begin of luns to use for target.Define set of luns to use for target.Define over-provision percentage for target.Instantiate a target on top of a LightNVM enabled device.media manager to initialize on top of device. Default: gennvm.Initialize LightNVM device. A LightNVM/Open-Channel SSD must have a media manager associated before it can be exposed to the user. The default is to initialize the general media manager on top of the device. Example: lnvm-init -d nvme0n1Print normal in readable formatRetrieve the chunk information log for the specified given LightNVM device, returns in either human-readable or binary format. This will request Geometry first to get the num_grp,num_pu,num_chk first to figure out the total size of the log pages.cound not alloc for chunk log %dbytes get log page for chunk information failed identifier of desired namespace. default: 1Send an Identify Geometry command to the given LightNVM device, returns properties of the specified namespace in either human-readable or binary format.Show general information and registered target types with LightNVMList all devices registered with LightNVM.target name of the device to remove. e.g. target0.Remove an initialized LightNVM target.Create target on top of a LightNVM deviceInitialize media manager on LightNVM deviceList geometry for LightNVM deviceList general information and available target enginesList available LightNVM devicesClear Memblaze devices error log.set-feature:%02x (%s), value:%#08x Set Memblaze power management status (value 0 - 25w, 1 - 20w, 2 - 15w)Enable/Disable Latency Statistics Tracking. No argument prints current status.FW Select (e.g., --select=OOB, EEP, ALL)This performs a selective firmware download, which allows the user to select which firmware binary to update for 9200 devices. This requires a power cycle once the update completes. The options available are: OOB - This updates the OOB and main firmware EEP - This updates the eeprom and main firmware ALL - This updates the eeprom, OOB, and main firmwareNVME Admin command error:%s(%x) Update successful! Please power cycle for changes to take effect Get Memblaze power management ststus (value 0 - 25w, 1 - 20w, 2 - 15w)get-feature:0x%02x (%s), %s value: %#08x --------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------Timestamp Type QID CID NSID StartLBA NumLBA Latency Timestamp Type QID CID NSID StartLBA NumLBA Latency%4d%02d%02d--%02d:%02d:%02d.%03d UTC%-32s %-7x %-6x %-6x %-8x %4x%08x %-8x %-d Get Memblaze vendor specific additional smart log (optionally, for the specified namespace), and show it.Additional Smart Log for NVME device%-31s : %3d%% %s%u%s%u%s%u %-32s: %3d%% %lu%%%s%lu %-32s: %3d%% %s%u%s%u%s%u Total write in GB since last factory reset : %lu Total read in GB since last factory reset : %lu Thermal throttling status[1:HTP in progress] : %u Total thermal throttling minutes since power on : %u Maximum temperature in Kelvin since last factory reset : %u Minimum temperature in Kelvin since last factory reset : %u Maximum temperature in Kelvin since power on : %u Minimum temperature in Kelvin since power on : %u Current temperature in Kelvin : %u Maximum power in watt since power on : %u Minimum power in watt since power on : %u Current power in watt : %u Power loss protection normalized value : %u Percentage of wearleveling count left : %u Wearleveling count min erase cycle : %u Wearleveling count max erase cycle : %u Wearleveling count avg erase cycle : %u Total host write in GiB since device born : %llu Thermal throttling count since device born : %u PCIE Correctable Error Count of Port0 : %llu PCIE Correctable Error Count of Port1 : %llu End-to-End Error Detection Count : %llu Erase Fail Count : %llu Program Fail Count : %llu Read Fail Count : %llu %-32s : %3d%% %lu %-31s : %3d%% %s%u%s%u%s%u No enough parameters. abort...Set Memblaze high latency log input parameter p1,p2 p1 value: 0 is disable, 1 is enable p2 value: 1 .. 5000 mssetfeature: invalid formats %s setfeature: invalid high io latency threshold %d set-feature:0x%02X (%s), value:%#08x Memblaze IO Read Command Latency Histogram Memblaze IO Read Command Latency HistogramMemblaze IO Write Command Latency Histogram Memblaze IO Write Command Latency Histogram-------------------------------------------------- --------------------------------------------------Bucket Start End Value Bucket Start End Value Unsupported io latency histogram revision Unsupported io latency histogram revisionGet Latency Statistics log and show it.Memblaze vendor specific extensionsOutput Memblaze High Latency LogRetrieve IO Latency Statistics log, show itEnable and disable Latency Statistics loggingSet Memblaze Power Manager StatusGet Memblaze Power Manager StatusRetrieve Memblaze SMART Log, show itMemblaze clear error logMemblaze power managementselectflagInvalid select flag OOBEEPno firmware file provided No memory for f/w size:%d %d%s%-11d %-11s %-11s %-11u w+log_c3.csvGet Memblaze high latency logMemblaze High Latency Log 2.832.940.600.09.0300%c.%c%c.%c%c%c%c%s:%s %s:%x %-34s%-11s%s %-32s: %3d%% %lu , avg: , max: %-31s: %3d%% %lu %-32s: %3d%% %.3f%% %-32s: %3d%% %lu%% min%-32s: %3d%% %lu%s , cnt: sectors: %-32s: %3d%% %s%lu system_area_life_lefttotal_readtempt_since_born, curr: , min: power_consumptiontempt_since_bootuppower_loss_protectionread_fail_countthermal_throttle_timeflash_media_error2.13%s is not a valid number 0,0paraminput parametersMajor Revision : %d Minor Revision : %d memblazeclear-error-logClear error loglat-log-printSet Memblaze High Latency Loglat-stats-printselect-downloadSelective Firmware Downloadset-pm-statusget-pm-statusError Information Log IDNamespace Changed Log IDDevice Self Test Log IDEndurance Group Log IDANA Log IDPersistent Event Log IDDiscovery Log IDSanitize Status Log IDWDC Vendor Unique Log IDUnknown Log ID%Y-%m-%d %H:%M:%S%s.%03ld GMTwdc vsnwdc vsn : %s Controller : %s Serial Number: %-.*s %s ERROR : WDC: open : %s ERROR : WDC: write : %s ERROR : WDC : write : %s ERROR : WDC : fsync : %s %s: break, total size = 0x%x %s: NVMe Status:%s(%x) ERROR : WDC : malloc : %s ERROR : WDC : calloc : %s %5u %04d:%02d:%02d%16lu%2ufail #%d%16uEntryPower on HourPrevious FirmwareNew FirmwareSlotResult SMART Cloud Attributes :- XOR recovery count %lu Refresh counts %lu Incomplete shutdowns %u Percent free blocks %d Capacitor health %u Unaligned I/O %lu PLP start count %.0Lf Log page version %u Log page GUID 0x0x%lx%lx NVMe Errata Version %d Physical media units read hiPhysical media units read loBad user nand blocks - RawBad system nand blocks - RawXOR recovery countSoft ecc error countEnd to end corrected errorsEnd to end detected errorsSystem data percent usedRefresh countsMax User data erase countsMin User data erase countsCurrent throttling statusPCIe correctable error countIncomplete shutdownsPercent free blocksCapacitor healthUnaligned I/OSecurity Version NumberNUSE - Namespace utilizationPLP start countEndurance estimateLog page version0x%lx%lxLog page GUIDErrata Version FieldPoint Version FieldMinor Version FieldMajor Version FieldNVMe Errata VersionPCIe Link Retraining CountNAND Bytes Written HiNAND Bytes Written LoNAND Bytes Read HiNAND Bytes Read LoNAND Bad Block Count (Raw)Uncorrectable Read CountSoft ECC Error CountSystem Data Percent UsedUser Data Erase Counts MaxUser Data Erase Counts MinRefresh CountProgram Fail Count (Raw)Thermal Throttling StatusThermal Throttling CountIncomplete Shutdown CountePercent Free BlocksOutput file pathname.transfer-sizeData retrieval transfer size.Enclosure Log Page ID.Get Enclosure Log.OpenFlexwb%s: ERROR : opening:%s : %s args - sz:%x logid:%x of:%s %s: ERROR : malloc : %s No Log/Crashdump available %s%.*s%s_pfail_dump_crash_dumpreason_id/usr/local/nvmecli%s/%s%s Realloc Block Count %u ECC Rate %u Write Amp %u Percent Life Remaining %u Program Fail Count %u Erase Fail Count %u Raw Read Error Rate %u Realloc Block CountECC RateWrite AmpPercent Life RemainingRaw Read Error RateOutput Format: normal|jsonTrimFeature StatusActive Bucket TimerActive Bucket Timer ThresholdActive Threshold AActive Threshold BActive Threshold CActive Threshold DActive Latency ConfigActive Latency Stamp UnitsStatic Latency Stamp UnitsDebug Log Trigger EnableRetrieve PCIE statistics. PCIE Statistics :- ECRC Error Status CounterMalformed TLP Status CounterComplete Abort Status CounterPoisoned TLP Status CounterBad DLLP Status CounterBad TLP Status CounterReceiver Error Status CounterSend a capabilities command.Current Composite TemperatureWCTEMPCCTEMPDITT supportHCTM supportHCTM Light (TMT1)TMT1 Transition CounterTMT1 Total TimeHCTM Light (TMT2)TMT2 Transition CounterTMT2 Total TimeThermal Shutdown Threshold%s: Invalid format Send a vs-drive-info command.Drive HW Revison: %4.1f FTL Unit Size: 0x%x KB Customer SN: %-.*s %4.1fDrive HW RevisonFTL Unit SizeCustomer SNDrive HW Revision: %c.%c Customer SN: %-.*s %c.%cThe namespace id to resize.op-option%02u%02u%02u_%02u%02u%02u%s: filename = %s %s: reason id file = %s ERROR : WDC : Invalid option Send a Resize command.New size: %lu GB dir-nameDIRECTORYOutput directory pathname.Capture Drive Essentials.DRIVE_ESSENTIALS%s_%s_%s_%sIdentifyController%s%s%s_%s_%s.binIdentifyNamespaceErrorLogSmartLogFwSLotLogLogPage%s%s%s_%s_%s_%s.binFEATURE_ID_%s%s%s0x%x_%s_%s_%s.bindumptracecore_dumpevent_logmanufacturing_info.tar.gz%s%s%s%s%s*.bintar -czfRetrieve NAND statistics. NAND Statistics :- NAND Erase Failures %u log page version %u NAND Statistics V3:- Refresh Count %lu Unaligned I/O %lu NAND Writes TLC (Bytes)NAND Writes SLC (Bytes)NAND Program FailuresNAND Erase FailuresBad Block CountE2E Error CounterBad NAND Blocks Count - RawNAND XOR Recovery countUECC Read Error countSystem data % life-usedProgram Fail Count - RawErase Fail Count - NormalizedErase Fail Count - RawPCIe Correctable Error Count% Free Blocks (User)% Free Blocks (System)Data Set Management Commands%% of completed trimEndurance EstimatePhysical Media Units Readlog page versionfile-sizeDisplay more debug messages.Internal Firmware Log.ERROR : WDC : Invalid length _internal_fw_log_%sHOSThostCONTROLLERfull_log%s%s%s_%s.binkey_logcore_dump_logextended_logPurge State Idle.Purge State Done.Purge State Busy.Unknown.Send a Purge Monitor command.Purge state = 0x%0x Purge Progress = %f%% ERROR : WDC Send a Purge command.Get Pfail Crash Dump.Get Crash Dump.Capture Drive Log.drive_logCapture Diagnostics Log.cap_diagRetrieve Log Page Directory.0x%x - %s Get Drive Status. Drive Status :- Percent Used: %u%% Drive Life Status: Normalintervallog-page-versionlog-page-maskdesired namespace id Invalid Field ID = %d wear_leveling-normalizedHost Read CommandsHost Read BlocksAverage Read SizeHost Read Cache Hit CommandsHost Read Cache Hit BlocksAverage Read Cache Hit SizeHost Read Commands StalledHost Write CommandsHost Write BlocksAverage Write SizeHost Write Odd Start CommandsHost Write Odd End CommandsHost Write Commands StalledNAND Read CommandsNAND Read Blocks CommandsAverage NAND Read SizeNand Write CommandsNAND Write BlocksAverage NAND Write SizeNAND Read Before WrittenLifetime Power on HoursLifetime UECC CountReserve Erase Block CountLifetime Program Fail CountLifetime Die Failure CountMax Recorded TemperatureLifetime Retired Block CountLifetime NAND WritesCapacitor HealthLifetime User WritesLifetime User Readswdc1.15.4get-latency-monitor-logvs-pcie-statsWDC VS PCIE Statisticscloud-SSD-plugin-versionWDC Cloud SSD Plugin VersionWDC Device Capabilitiesvs-temperature-statsWDC Get Temperature Statsvs-drive-infoWDC Get Drive Infonamespace-resizeWDC NamespaceDrive Resizelog-page-directoryWDC Get Log Page Directoryvs-error-reason-identifierenc-get-logWDC Get Enclosure Logclear-fw-activate-historyWDC Clear FW Activate Historyvs-fw-activate-historyWDC Get FW Activate Historydrive-resizeWDC Drive Resizeclear-assert-dumpWDC Clear Assert Dumpget-drive-statusWDC Get Drive Statusdrive-essentialsWDC Drive Essentialsclear-pcie-correctable-errorsvs-smart-add-logWDC Additional Smart Logvs-nand-statsWDC NAND Statisticsvs-internal-logWDC Internal Firmware Logpurge-monitorWDC Purge MonitorpurgeWDC PurgeWDC identify controllerget-pfail-dumpWDC Pfail Dumpget-crash-dumpWDC Crash Dumpdrive-logWDC Drive Logcap-diagWDC Capture-DiagnosticsSmart/Health Information Log IDFirmware Slot Information Log IDCommamds Supported and Effects Log IDTelemetry Host Initiated Log IDTelemetry Controller Generated Log IDReservation Notification Log IDERROR : WDC : %s : calloc failed /sys/class/nvme/%s/device/vendor/sys/class/misc/%s/device/vendorERROR : WDC : %s : Open vendor file failed %s: Read of pci vendor id failed /sys/class/nvme/%s/device/device/sys/class/misc/%s/device/deviceERROR : WDC : %s : Open device file failed %s: Read of pci device id failed Latency Monitor/C3 Log Page Data Feature Status 0x%x Active Bucket Timer %d min Active Bucket Timer Threshold %d min Active Threshold A %d ms Active Threshold B %d ms Active Threshold C %d ms Active Threshold D %d ms Active Latency Config 0x%x Active Latency Minimum Window %d ms Active Latency Stamp Units %d Static Latency Stamp Units %d Debug Log Trigger Enable %d Read Write Deallocate/Trim ERROR : WDC : latency monitor read id ctrl failure, err = %d Active Bucket Counter: Bucket %d %27d %27d %27d Active Measured Latency: Bucket %d %27d ms %27d ms %27d ms Active Latency Time Stamp: Bucket %d N/A Static Bucket Counter: Bucket %d %27d %27d %27d Static Measured Latency: Bucket %d %27d ms %27d ms %27d ms Static Latency Time Stamp: Bucket %d ERROR : WDC: invalid log file length %s: Controller initiated option telemetry log page disabled ERROR : WDC: Get telemetry option feature failed. NVMe Status:%s(%x) %s: Invalid type parameter; type = %d %s: Failed to allocate 0x%x bytes for log: %s %s: Failed to open output file %s: %s! %s: Failed to acquire telemetry header! %s: Failed to flush header data to file!, err = %d %s: Invalid data area requested, data area = %d %s: Failed to acquire full telemetry log! %s: Failed to flush telemetry data to file!, err = %d ERROR : WDC : nvme_identify_ctrl() failed 0x%x ERROR : WDC: unsupported WDC device, Vendor ID = 0x%x, Device ID = 0x%x ERROR : WDC : VUReadBuffer() failed, status:%s(0x%x) ERROR : WDC : reading DUI data failed ERROR : WDC : reading DUI data V2 failed %s: ERROR : log header malloc failed : status %s, size 0x%x %s: ERROR : WDC : Get DUI headers failed %s: ERROR : WDC : NVMe Status:%s(%x) INFO : WDC : Capture V1 Device Unit Info log, data area = %d INFO : WDC : DUI Header Version = 0x%x INFO : WDC : Capture V1 Device Unit Info log is empty %s: Data area ID %d : section size 0x%x, total size = 0x%x %s: ERROR : dump data V1 malloc failed : status %s, size = 0x%x %s: Failed to flush header data to file! %s: ERROR : WDC : Get chunk %d, size = 0x%lx, offset = 0x%x, addr = %p %s: ERROR : WDC : Failed to flush DUI data to file! chunk %d, err = 0x%x, xfer_size = 0x%x INFO : WDC : Capture V2 or V3 Device Unit Info log, data area = %d INFO : WDC : DUI Product ID = 0x%x/%c INFO : WDC : Capture V2 or V3 Device Unit Info log is empty %s: Data area ID %d : section size 0x%x, total size = 0x%lx %s: break, total size = 0x%lx %s: INFO : WDC : Offset 0x%lx exceeds total size 0x%lx, no data retrieved %s: ERROR : dump data v3 malloc failed : status %s, size = 0x%lx %s: INFO : WDC : Offset 0x%lx, file size 0x%lx, total size 0x%lx, log size 0x%lx %s: ERROR : WDC : Get chunk %d, size = 0x%lx, offset = 0x%lx, addr = %p %s: ERROR : WDC : Failed to flush DUI data to file! chunk %d, err = 0x%x, xfer_size = 0x%lx INFO : WDC : Capture V4 Device Unit Info log, data area = %d INFO : WDC : DUI log size sectors = 0x%x INFO : WDC : DUI cap_dui_length = 0x%lx INFO : WDC : Capture V4 Device Unit Info log is empty %s: Data area ID %d : section size 0x%x sectors, section size 0x%lx bytes, total size = 0x%lx %s: ERROR : dump data V4 malloc failed : status %s, size = 0x%x %s: ERROR : WDC : Failed to flush DUI data to file! chunk %d, err = 0x%x, xfer_size_long = 0x%lx INFO : WDC : Unsupported header version = 0x%x INFO : WDC : Capture Device Unit Info log, length = 0x%lx ERROR : WDC : Invalid buffer to read fw activate history entries Firmware Activate History Log Power on Hour Power Cycle Previous New Entry hh:mm:ss Count Firmware Firmware Slot Action Result ----- ----------------- ----------------- --------- --------- ----- ------ ------- Power Cycle Previous New Entry Timestamp Count Firmware Firmware Slot Action Result Power on Hour Power Cycle Previous New Entry hh:mm:ss Count Firmware Firmware Slot Action Result ----- -------------- -------------------- ---------- ---------- ----- ------ -------ERROR : WDC : Invalid buffer to read 0xC0 log Physical media units written - %lu %lu Physical media units read - %lu %lu Bad user nand blocks - Raw %lu Bad user nand blocks - Normalized %d Bad system nand blocks - Raw %lu Bad system nand blocks - Normalized %d Uncorrectable read error count %lu Soft ecc error count %lu End to end corrected errors %u End to end detected errors %u System data percent used %d Max User data erase counts %u Min User data erase counts %u Number of Thermal throttling events %d Current throttling status 0x%x PCIe correctable error count %lu Security Version Number %lu NUSE - Namespace utilization %lu Endurance estimate %.0Lf Errata Version Field %d Point Version Field %u Minor Version Field %u Major Version Field %d PCIe Link Retraining Count %lu Physical media units written hiPhysical media units written loBad user nand blocks - NormalizedBad system nand blocks - NormalizedUncorrectable read error countNumber of Thermal throttling eventsERROR : WDC : Invalid buffer to read perf stats CA Log Page Performance Statistics :- NAND Bytes Written %20lu%20lu NAND Bytes Read %20lu%20lu NAND Bad Block Count (Normalized) %20lu NAND Bad Block Count (Raw) %20lu Uncorrectable Read Count %20lu Soft ECC Error Count %20lu SSD End to End Detected Correction Count %20u SSD End to End Corrected Correction Count %20u System Data Percent Used %20u%% User Data Erase Counts Max %20u User Data Erase Counts Min %20u Refresh Count %20lu Program Fail Count (Normalized) %20lu Program Fail Count (Raw) %20lu User Data Erase Fail Count (Normalized) %20lu User Data Erase Fail Count (Raw) %20lu System Area Erase Fail Count (Normalized) %20lu System Area Erase Fail Count (Raw) %20lu Thermal Throttling Status %20u Thermal Throttling Count %20u PCIe Correctable Error Count %20lu Incomplete Shutdown Count %20u Percent Free Blocks %20u%% NAND Bad Block Count (Normalized)SSD End to End Detected Correction CountSSD End to End Corrected Correction CountProgram Fail Count (Normalized)User Data Erase Fail Count (Normalized)User Data Erase Fail Count (Raw)System Area Erase Fail Count (Normalized)System Area Erase Fail Count (Raw)ERROR : WDC: unsupported WDC enclosure, Model = %s Invalid log identifier: %d. Valid 0xd1, 0xd2, 0xd3, 0xd4, 0xe2, 0xe4 %s: ERROR : WDC : Get chunk %d, size = 0x%x, offset = 0x%x, addr = 0x%lx %s: WARNING : WDC : No log ID:x%x available %s: ERROR : WDC : NVMe Snd Mgmt Status:%s(x%x) %s: ERROR : WDC : NVMe Rcv Mgmt Status:%s(x%x) %s: ERROR : WDC : NVMe Rcv Mgmt response size:x%x not LW aligned ERROR:0x%x Failed to collect log-id:%x %s: ERROR : xfer-size (%d) must be a power of 2 ERROR : WDC : reading dump length failed INFO : WDC : Capture Diagnostics log is empty %s: FAILURE: NVMe Status:%s(%x) %s: Partial data may have been captured INFO : WDC : Capture Diagnostics log, length = 0x%x ERROR : WDC : cannot format serial number due to data of unexpected length ERROR : WDC : failed to generate file name INFO : WDC: Pfail dump get size failed INFO : WDC: Crash dump get size failed INFO : WDC: Pfail dump is empty INFO : WDC: Crash dump is empty ERROR : WDC : Crash dump erase failed ERROR : WDC : VUReadSize() failed, status:%s(0x%x) %s: ERROR : failed to get drive reason id End of Life Log Page 0xC0 :- ERROR : WDC - wdc_get_dev_mng_log_entry: No ppLogEntry pointer. ERROR : WDC - wdc_get_dev_mng_log_entry: Buffer is not large enough for the common header. BufSize: 0x%x HdrSize: %lx ERROR : WDC: wdc_get_dev_mng_log_entry: Detected unaligned end of the data. Data Offset: 0x%x Entry Size: 0x%x, Remaining Log Length: 0x%x Entry Id: 0x%x ERROR : WDC: wdc_get_dev_mng_log_entry: Invalid entry found at offset: 0x%x Entry Size: 0x%x, Remaining Log Length: 0x%x Entry Id: 0x%x ERROR : WDC : Unable to get 0x%x Log Page length, ret = 0x%x ERROR : WDC : Unable to read 0x%x Log Page data, ret = 0x%x ERROR : WDC : Unable to find correct version of page 0x%x, entry id = %d ERROR : WDC : cbs_data ptr = NULL ERROR : WDC : 0xC2 Log Page entry ID 0x%x not found %s: ERROR : WDC : 0xC2 Log Page entry ID 0x%x not found Retrieve latency monitor log data.ERROR : WDC: unsupported device for this command ERROR : WDC : invalid output format ERROR : WDC : invalid latency monitor version ERROR : WDC : Unknown GUID in C3 Log Page data ERROR : WDC : Expected GUID: 0x ERROR : WDC : Actual GUID: 0xActive Lantency Minimum WindowActive Bucket Counter: Bucket %d %sActive Measured Latency: Bucket %d %sActive Latency Time Stamp: Bucket %d %sStatic Bucket Counter: Bucket %d %sStatic Measured Latency: Bucket %d %sStatic Latency Time Stamp: Bucket %d %sERROR : WDC : Unable to read C3 data from buffer ERROR : WDC : Failure reading the C3 Log Page, ret = %d ERROR : WDC : PCIE Stats alloc : %s ERROR : WDC : Failure reading PCIE statistics, ret = 0x%x Unsupported Request Error Counter %20lu ECRC Error Status Counter %20lu Malformed TLP Status Counter %20lu Receiver Overflow Status Counter %20lu Unexpected Completion Status Counter %20lu Complete Abort Status Counter %20lu Completion Timeout Status Counter %20lu Flow Control Error Status Counter %20lu Poisoned TLP Status Counter %20lu Dlink Protocol Error Status Counter %20lu Advisory Non Fatal Error Status Counter %20lu Replay Timer TO Status Counter %20lu Replay Number Rollover Status Counter %20lu Bad DLLP Status Counter %20lu Bad TLP Status Counter %20lu Receiver Error Status Counter %20lu Unsupported Request Error CounterReceiver Overflow Status CounterUnexpected Completion Status CounterCompletion Timeout Status CounterFlow Control Error Status CounterDlink Protocol Error Status CounterAdvisory Non Fatal Error Status CounterReplay Timer TO Status CounterReplay Number Rollover Status CounterGet Cloud SSD Plugin Version command.WDC Cloud SSD Plugin Version: 1.0WDC Plugin Capabilities for NVME device:%s cap-diag : %s drive-log : %s get-crash-dump : %s get-pfail-dump : %s id-ctrl : Supportedpurge : %s purge-monitor : %s vs-internal-log : %s vs-nand-stats : %s vs-smart-add-log : %s --C0 Log Page : %s --C1 Log Page : %s --C3 Log Page : %s --CA Log Page : %s --D0 Log Page : %s clear-pcie-correctable-errors : %s drive-essentials : %s get-drive-status : %s clear-assert-dump : %s drive-resize : %s vs-fw-activate-history : %s clear-fw-activate-history : %s vs-telemetry-controller-option: %s vs-error-reason-identifier : %s log-page-directory : %s namespace-resize : %s vs-drive-info : %s vs-temperature-stats : %s cloud-SSD-plugin-version : %s vs-pcie-stats : %s capabilities : SupportedSend a vs-temperature-stats command.Temperature Stats for NVME device:%s namespace-id:%x Current Composite Temperature : %d °C WCTEMP : %u °C CCTEMP : %u °C DITT support : 0HCTM support : %u HCTM Light (TMT1) : %u °C TMT1 Transition Counter : %u TMT1 Total Time : %u HCTM Heavy (TMT2) : %u °C TMT2 Transition Counter : %u TMT2 Total Time : %u Thermal Shutdown Threshold : 95 °CERROR : WDC %s invalid output format ERROR : WDC %s: Identify Controller failed The over provisioning option to set for namespace.Send a Namespace Resize command.ERROR : WDC: unsupported OP option parameter ERROR : WDC: Namespace Resize of namespace id 0x%x, op option 0x%x failed Log ID to retrieve - host - 7 or controller - 8File name to save raw binary identifierRetrieve telemetry log reason identifier.ERROR : WDC: Invalid Log ID. It must be 7 (Host) or 8 (Controller) _error_reason_identifier_ctlr_%s_error_reason_identifier_host_%sERROR : WDC: failed to generate file name %s: ERROR : malloc failed, size : 0x%x, status : %s %s: ERROR : Failed to acquire telemetry header, ret = %d! %s: ERROR : get telemetry header failed, ret : %d Disable controller option of the telemetry log page.Enable controller option of the telemetry log page.Displays the current state of the controller initiated log page.Disable/Enable Controller Option of the Telemetry Log Page.Controller Option Telemetry Log Page State: Disabled Controller Option Telemetry Log Page State: Enabled ERROR : WDC: NVMe Status:%s(%x) ERROR : WDC: unsupported option for this command Please provide an option, -d, -e or -s Clear FW activate history table.The new size (in GB) to resize the drive to.ERROR : WDC : get serial # and fw revision failed Get Drive Essentials Data for device serial #: %s and fw revision: %s ERROR : WDC : get current working directory failed ERROR : WDC : create directory failed, ret = %d, dir = %s Store Drive Essentials bin files in directory: %s ERROR : WDC : nvme_identify_ctrl() failed, ret = %d ERROR : WDC : nvme_identify_ns() failed, ret = %d ERROR : WDC : nvme_error_log() failed, ret = %d ERROR : WDC : nvme_smart_log() failed, ret = %d ERROR : WDC : nvme_fw_log() failed, ret = %d ERROR : WDC : nvme_get_log() for log page 0x%x failed, ret = %d ERROR : WDC : nvme_get_feature id 0x%x failed, ret = %d WDC : wdc_get_log_dir_max_entries failed, ret = %d ERROR : WDC : %s: Failed to get headerPayloadSize from file directory 0x%x ERROR : WDC : %s: Failed to get fileIdOffsets from file directory 0x%x ERROR : WDC : %s: Failed to get filesystem directory size, ret = %d ERROR : WDC : %s: Failed to get filesystem directory, ret = %d ERROR : WDC : File Size for %s is 0 ERROR : WDC : %s: wdc_de_VU_read_buffer failed with ret = %d, fileId = 0x%x, fileSize = 0x%lx ERROR : WDC : wdc_fetch_log_file_from_device: %s failed, ret = %d WDC : wdc_fetch_log_directory failed, ret = %d ERROR : WDC : %s: wdc_de_VU_read_size failed with ret = %d ERROR : WDC : %s: wdc_de_VU_read_size failed, read size is less than 4 bytes, dumptraceSize = 0x%x ERROR : WDC : %s: readBuffer calloc failed ERROR : WDC : %s: wdc_de_VU_read_buffer failed, ret = %d on offset 0x%x ERROR : WDC : %s: Read Buffer Loop failed, ret = %d ERROR : WDC : %s: wdc_WriteToFile failed, ret = %d ERROR : WDC : wdc_de_get_dump_trace failed, ret = %d ERROR : WDC : Tar of Drive Essentials data failed, ret = %d Get of Drive Essentials data successful Clear PCIE Correctable Errors.ERROR : WDC : %s : Failed to retreive NAND stats NAND Writes TLC (Bytes) %.0Lf NAND Writes SLC (Bytes) %.0Lf NAND Program Failures %u Bad Block Count %u NAND XOR/RAID Recovery Trigger Events %lu E2E Error Counter %lu Number Successful NS Resizing Events %lu TLC Units Written %.0Lf SLC Units Written %.0Lf Bad NAND Blocks Count - Normalized %u Bad NAND Blocks Count - Raw %lu NAND XOR Recovery count %lu UECC Read Error count %lu SSD End to End corrected errors %lu SSD End to End detected errors %u SSD End to End uncorrected E2E errors %u System data %% life-used %u User Data Erase Counts - TLC Min %lu User Data Erase Counts - TLC Max %lu User Data Erase Counts - SLC Min %lu User Data Erase Counts - SLC Max %lu Program Fail Count - Normalized %u Program Fail Count - Raw %lu Erase Fail Count - Normalized %u Erase Fail Count - Raw %lu PCIe Correctable Error Count %u %% Free Blocks (User) %u Security Version Number %lu %% Free Blocks (System) %u Data Set Management Commands %.0Lf Estimate of Incomplete Trim Data %lu %% of completed trim %u Background Back-Pressure-Guage %u Soft ECC Error Count %lu Bad System Nand Block Count - Normalized %u Bad System Nand Block Count - Raw %lu Endurance Estimate %.0Lf Thermal Throttling Count %u Thermal Throttling Status %u Physical Media Units Read %.0Lf WDC: Nand Stats ERROR : Invalid version NAND XOR/RAID Recovery Trigger EventsNumber Successful NS Resizing EventsBad NAND Blocks Count - NormalizedSSD End to End corrected errorsSSD End to End detected errorsSSD End to End uncorrected E2E errorsUser Data Erase Counts - SLC MinUser Data Erase Counts - SLC MaxUser Data Erase Counts - TLC MinUser Data Erase Counts - TLC MaxProgram Fail Count - NormalizedEstimate of Incomplete Trim DataBackground Back-Pressure-GuageBad System Nand Block Count - NormalizedBad System Nand Block Count - Raw%s: Invalid Stats Version = %d ERROR : WDC : Failure reading NAND statistics, ret = %d Data area to retrieve up to. Currently only supported on the SN340, SN640, SN730, and SN840 devices.Output file size. Currently only supported on the SN340 device.Output file data offset. Currently only supported on the SN340 device.Telemetry type - NONE, HOST, or CONTROLLER. Currently only supported on the SN640 and SN840 devices.ERROR : WDC: Data area must be 1-5 ERROR : WDC: Invalid type - Must be NONE, HOST or CONTROLLER Stored log files in directory: %s ERROR : WDC : Tar of log data failed, ret = %d Purge Operation resulted in an error that requires power cycle.The previous purge operation was interrupted by a power cycle or reset interruption. Other commands may be rejected until Purge Execute is issued and completed.ERROR : WDC : Cannot execute purge, Purge operation is in progress. ERROR : WDC : Internal Device Error. ERROR : WDC : failed to read pfail crash dump ERROR : WDC : failed to read crash dump Output Format: normal|json|binary%s: ERROR : WDC : invalid output format %s: ERROR : WDC : 0x%x Log Page not supported %s: ERROR : WDC : Invalid format, format = %s %s: ERROR : WDC : NULL_data ptr INFO : WDC : No FW Activate History entries found. ERROR : WDC : Unable to read FW Activate History Log Page data Retrieve FW activate history table.ERROR : WDC : %d Log Page not supported ERROR : WDC : Invalid number entries found in FW Activate History Log Page - %d ERROR : WDC : Failure reading the FW Activate History, ret = %d Clear Assert Dump Present Status.ERROR : WDC : Get Assert Status Failed INFO : WDC : No Assert Dump Present ERROR : WDC : 0xC2 Log Page not supported ERROR : WDC : Get Thermal Throttling Status Failed ERROR : WDC : Get User EOL Status Failed ERROR : WDC : Get User EOL State Failed ERROR : WDC : Get System EOL State Failed ERROR : WDC : Get Format Corrupt Reason Failed Drive Life Status: End Of Life Drive Life Status: Read Only Drive Life Status: Unknown : 0x%08x/0x%08x Assert Dump Status: Present Assert Dump Status: Not Present Assert Dump Status: Unknown : 0x%08x Thermal Throttling Status: Off Thermal Throttling Status: On Thermal Throttling Status: Unavailable Thermal Throttling Status: Unknown : 0x%08x Format Corrupt Reason: Format Not Corrupted Format Corrupt Reason: Format Corrupt due to FW Assert Format Corrupt Reason: Format Corrupt for Unknown Reason Format Corrupt Reason: Unknown : 0x%08x Interval to read the statistics from [1, 15].Log Page Version: 0 = vendor, 1 = WDCLog Page Mask, comma separated list: 0xC0, 0xC1, 0xCA, 0xD0Retrieve additional performance statistics.ERROR : WDC: unsupported log page version for this command ERROR: WDC: log page list is malformed ERROR : WDC: Unknown log page mask - %s ERROR : WDC : Unknown GUID in C0 Log Page data ERROR : WDC : Unable to read C0 Log Page data ERROR : WDC : Unknown device id - 0x%x ERROR : WDC : Failure reading the C0 Log Page, ret = %d ERROR : WDC : 0xCA Log Page not supported ERROR : WDC : Unable to read CA Log Page data ERROR : WDC : Unsupported Customer id, id = 0x%x ERROR : WDC : Invalid buffer to read data key normalized rawprogram_fail_count : %3u%% %lu erase_fail_count : %3u%% %lu wear_leveling : %3u%% min: %u, max: %u, avg: %u end_to_end_error_detection_count: %3u%% %lu crc_error_count : %3u%% %lu timed_workload_media_wear : %3u%% %-.3f%% timed_workload_host_reads : %3u%% %lu%% timed_workload_timer : %3u%% %lu thermal_throttle_status : %3u%% %u%%, cnt: %u retry_buffer_overflow_count : %3u%% %lu pll_lock_loss_count : %3u%% %lu nand_bytes_written : %3u%% sectors: %.f host_bytes_written : %3u%% sectors: %.f ERROR : WDC : Log page 0xCA not supported for this device ERROR : WDC : Failure reading the CA Log Page, ret = %d ERROR : WDC : interval out of range [1-15] ERROR : WDC : Unable to read data from buffer C1 Log Page Performance Statistics :- Host Read Commands %20lu Host Read Blocks %20lu Average Read Size %20lf Host Read Cache Hit Commands %20lu Host Read Cache Hit_Percentage %20lu%% Host Read Cache Hit Blocks %20lu Average Read Cache Hit Size %20f Host Read Commands Stalled %20lu Host Read Commands Stalled Percentage %20lu%% Host Write Commands %20lu Host Write Blocks %20lu Average Write Size %20f Host Write Odd Start Commands %20lu Host Write Odd Start Commands Percentage %20lu%% Host Write Odd End Commands %20lu Host Write Odd End Commands Percentage %20lu%% Host Write Commands Stalled %20lu Host Write Commands Stalled Percentage %20lu%% NAND Read Commands %20lu NAND Read Blocks Commands %20lu Average NAND Read Size %20f Nand Write Commands %20lu NAND Write Blocks %20lu Average NAND Write Size %20f NAND Read Before Write %20lu Host Read Cache Hit PercentageHost Read Commands Stalled PercentageHost Write Odd Start Commands PercentageHost Write Odd End Commands PercentageHost Write Commands Stalled PercentageERROR : WDC : Failure reading the C1 Log Page, ret = %d ERROR : WDC : 0xD0 Log Page not supported D0 Smart Log Page Statistics :- Lifetime Reallocated Erase Block Count %20u Lifetime Power on Hours %20u Lifetime UECC Count %20u Lifetime Write Amplification Factor %20u Trailing Hour Write Amplification Factor %20u Reserve Erase Block Count %20u Lifetime Program Fail Count %20u Lifetime Block Erase Fail Count %20u Lifetime Die Failure Count %20u Lifetime Link Rate Downgrade Count %20u Lifetime Clean Shutdown Count on Power Loss %20u Lifetime Unclean Shutdowns on Power Loss %20u Current Temperature %20u Max Recorded Temperature %20u Lifetime Retired Block Count %20u Lifetime Read Disturb Reallocation Events %20u Lifetime NAND Writes %20lu Capacitor Health %20u%% Lifetime User Writes %20lu Lifetime User Reads %20lu Lifetime Thermal Throttle Activations %20u Percentage of P/E Cycles Remaining %20u%% Lifetime Reallocated Erase Block CountLifetime Write Amplification FactorTrailing Hour Write Amplification FactorLifetime Block Erase Fail CountLifetime Link Rate Downgrade CountLifetime Clean Shutdown Count on Power LossLifetime Unclean Shutdowns on Power LossLifetime Read Disturb Reallocation EventsLifetime Thermal Throttle ActivationsPercentage of P/E Cycles RemainingERROR : WDC : Unable to read D0 Log Page data ERROR : WDC : Failure reading the D0 Log Page, ret = %d Western Digital vendor specific extensionsWDC Get Latency Monitor Log PageWDC Telemetry Reason Identifiervs-telemetry-controller-optionWDC Enable/Disable Controller Initiated Telemetry LogWDC Clear PCIe Correctable Error Countp`P@0 $4DTdԬwdc_do_dumpwdc_do_cap_duiwdc_do_cap_telemetry_logwdc_do_dump_e6wdc_do_cap_diagwdc_vs_internal_fw_logwdc_print_nand_stats_jsonwdc_do_vs_nand_statswdc_get_ca_log_pagewdc_get_c0_log_pagewdc_de_get_dump_tracewdc_fetch_log_file_from_devicewdc_fetch_log_directorywdc_get_log_dir_max_entrieswdc_get_fw_act_history_C2wdc_enc_submit_move_datawdc_enc_get_nic_logwdc_enc_get_logwdc_clear_reason_idwdc_save_reason_idwdc_dump_telemetry_hdrwdc_do_get_reason_idwdc_reason_identifierwdc_log_page_directorywdc_vs_drive_infowdc_vs_temperature_statswdc_get_enc_drive_capabilitieswdc_get_pci_idswdc_get_drive_capabilitiesů(Oo|կzЄlpCX^ԅ?P?@_/usr/local/nvmecarray namearray name : %s /devHuaweiNS NameArray NameNS IDNguidhuaweiHuawei identify controllerRetrieve basic information for the given huawei device%-*.*s %-*.*s %-*.*s %-*.*s %-*.*s %-*.*s %-.*s %-.*s %-.*s %-.*s %-.*s %-.*s %-*.*s %-*.*s %-*.*s %-*d %-*.*s %-*.*s Huawei vendor specific extensionsList all Huawei NVMe devices and namespaces on machinecolumnNo NVMe devices detected. Unable to open %s: %s NetApp ONTAP Controllerioctl error %0x Namespace PathVserverUUID-------------------------%.2f%sB/vol/Namespace_PathLBA_Data_SizeNamespace_SizeNetApp E-SeriesVolume NameAccess StateCtrlVolume IDArray_NameVolume_NameVolume_IDAccess_StatenetappontapdevicesNetApp ONTAPdevicessmdevicesNetApp SMdevicesOutput Format: normal|json|columnDisplay information about ONTAP devices.Unrecognized output format: %s Unable to allocate memory for devices. Identify Controller failed to %s (%s) Unable to identify namespace for %s (%s) Unable to identify namespace descriptor for %s (%s) Unable to get log page data for %s (%s) %-16s %-25s %-50s %-4s %-38s %-9s --------------------------------------Unable to fetch ONTAP vserver name Unable to fetch ONTAP volume name Unable to fetch ONTAP namespace name Display information about E-Series volumes.%-16s %-30s %-30s %-4s %-32s %-4s %-12s %-9s NetApp vendor specific extensions%s, Vserver %s, Namespace Path %s, NSID %d, UUID%-16s %-25s %-50s %-4d %-38s %-9%s, Array Name %s, Volume Name %s, NSID %d, Volume ID %s, Controller %c, Access %-16s %-30s %-30s %4d %32s %c %s: SCT status failed :%d %s: NVMe Status:%s(%x) ] %d %% prev-logGetting previous logGetting current logPage: %u of %zu %s: couldn't output file %s Page: %zu of %zu %s: bad SCT status %s: couldn't get fw log %s: couldn't get log 0x%x Error Log : %u SMART Health Log : %u Firmware Slot Info : %u Command Effects : %u Device Self Test : %u Log Page Directory : %u SMART Attributes : %u toshibaToshiba NVME pluginGet Internal LogExtended SMART information%s: unexpected value in SCT status[0]:(%x) %s: command unsupported on this device: (0x%x) Clear PCIe correctable error count.%s: failed to parse arguments %s: couldn't clear PCIe correctable errors (optional) binary output filename(optional) use previous log. Otherwise uses current log.Get internal status log and show it.%s: SCT command transfer failed %s: SCT data transfer failed, page 0 %s: SCT data transfer command failed %s: couldn't write all data to output file (optional) log ID (0xC0, or 0xCA), default 0xCAGet extended SMART information and show it.%s: invalid log page 0x%x - should be 0xC0 or 0xCA Vendor Log Page Directory 0xC0 for NVME device:%s namespace-id:%x %s: couldn't get vendor log 0x%x %s: couldn't write all data to output file %s Clear PCIe correctable error countnvme_get_vendor_logvendor_lognvme_get_internal_loginternal_lognvme_get_sct_statusclear_correctable_errorsB0x%lx%016lxoutput format normal|json Device not found %u CTemperature Sensor #%d%-10s : %u C Temperature Sensor #%-10s%d : %u C ECRC Error Status (ECRCES)Malformed TLP Status (MTS)Completer Abort Status (CAS)Poisoned TLP Status (PTS)Bad DLLP Status (BDS)Bad TLP Status (BTS)Receiver Error Status (RES)output format json|normalRetrieve PCIe event counters/dev/nvmen1Invalid device specified!Failed to read device../../nvme/sys/block/%s/device/device/%x:%x:%x.%xPCIE Stats%-40s : %-1d PCIE Stats:0x%04x0x%02x%-40s : %-4s %-40s : %s firmware_slot_info_log.binnvmelog_C1.binnvmelog_C2.binnvmelog_C4.binnvmelog_C5.binnvmelog_D0.binnvmelog_E6.binnvmelog_E7.binlog typepackagedata_areatelemetry log: 0x%XOSSYSTEM INFORMATIONuname -a >> %slsmod >> %scat /proc/meminfo >> %sSYSTEM INTERRUPT INFORMATIONcat /proc/interrupts >> %sCPU INFORMATIONcat /proc/cpuinfo >> %sIO MEMORY MAP INFORMATIONcat /proc/iomem >> %sMAJOR NUMBER AND DEVICE GROUPcat /proc/devices >> %sKERNEL DMESGdmesg >> %s/VAR/LOG/MESSAGEScat /var/log/messages >> %sos_config.txttimestamp_info.txta+Failed to send "%s" drive-info.txtFailed to create %s Device NameFW-RevSerial NoModel NoVendorId%-22s : %04X %-22s : %04X DeviceIdsmart_data.binerror_information_log.bindrive_self_test.binfirmware logcommand_effects_log.binpersistent_event_log.binnvmetelemetrylog.binnvme_feature_setting_pm.binnvmelog_FB.binnvmelog_F7.binnvmelog_F8.binnvmelog_F9.binnvmelog_FC.binnvmelog_FD.binnvmelog_CA.binnvmelog_FA.binnvmelog_F6.binnvmelog_FE.binnvmelog_FF.binchanged_namespace_log.binlog 0x%x.tgztar -zcf "%s" "%s"rm -f -R "%s" >temp.txt 2>&1rm -f temp.txtfeature: 0x%XopenFailed to clear error countoutput format normalGet drive HW informationMicron Drive HW Information%hhu.%hhuDrive Hardware Version%hhu KBFTL_unit_sizeBoot Spec.VersionFTL_unit_size: %hhu KB 000b001b010b011b|%lu:%hhu:%hhu| %lu| %s| %d| Fail #%denable or disable or statusClear FW activation historyhottest componentcompositeRaw Bad User NAND Block CountXOR Recovery CountNormalized Program Fail CountRaw Program Fail CountNormalized Erase Fail CountRaw Erase Fail CountPcie Correctable Error CountIncomplete TRIM Data% Age of Completed TRIMLog Page VersionREAD CMDs exceeding thresholdLog Page GUIDPhysical Media Units WrittenMaximum User Data Erase CountMinimum User Data Erase CountPCIe Correctable Error countIncomplete Shutdowns% Free BlocksNUSEPLP Start CountNAND Writes (Bytes Written)Program Failure CountNSZE Change SupportedNumber of NSZE Modificationsmicronvs-smbus-optionRetrieve extended SMART dataRetrieve Error reasonDisplay FW activation historyRetrieve log page directoryDisplay plugin version infoRetrieve Drive informationRetrieve NAND StatsRetrieve Micron logsClear correctable PCIe errors/sys/class/misc/nvme%d/device/vendor/sys/class/misc/nvme%d/device/devicenvme-cli Micron cloud SSD plugin version: %s.%s nvme-cli Micron plugin version: %s.%s.%s This command is not implemented for the driveFailed to get telemetry log header for 0x%X Requested telemetry data for 0x%X is empty Failed to get telemetry data for 0x%x Retrieve Micron temperature info for the given device Micron temperature informationMicron temperature information:Advisory Non-Fatal Error Status (ANFES)Unsupported Request Error Status (URES)Receiver Overflow Status (ROS)Unexpected Completion Status (UCS)Completion Timeout Stats (CTS)Flow Control Protocol Error Status (FCPES)Data Link Protocol Error Status (DLPES)Replay Timer Timeout Status (RTS)REPLY NUM Rollover Status (RRS)Unsupported drive model for vs-pcie-stats commandsetpci -s %x:%x.%x ECAP_AER+10.LFailed to retrieve error countsetpci -s %x:%x.%x ECAP_AER+0x4.LDevice correctable errors detected: %s Device uncorrectable errors detected: %s FW Select (e.g., --select=ALL)Update successful! Power cycle for changes to take effect Extended Smart Log Page : 0xFBRetrieve Micron NAND stats for the given device Error %d retrieving controller identification data Unsupported drive model for vs-nand-stats commandExtended Smart Log Page : 0xD0telemetry log type - host or controllerLog output data file name (required)telemetry log data area 1, 2 or 3This retrieves the micron debug log packagetelemetry type (host or controller) should be specified i.e. -t=hostdata area must be selected using -d option ie --d=1,2,3data area option is valid only for telemetry option (i.e --type=host|controller)Log data file must be specified. ie -p=logfile.binLog data file must be specified. ie -p=logfile.zip or -p=logfile.tgz|logfile.tar.gzUnsupported drive model for vs-internal-log collectiontelemetry option is not supported for specified drivePreparing log package. This will take a few seconds...nvme_controller_identify_data.binLINUX KERNEL MODULE INFORMATIONLINUX SYSTEM MEMORY INFORMATIONTimestamp (UTC): %a, %d %b %Y %T %z %s ----------------------------------------------- %-20s : /dev/nvme%d %-20s : %s %-20s : %-20s %-20s : %-20s identify_namespace_%d_data.binSetting persistent event log read ctx failed (ignored)! could not alloc buffer for persistent event log page (ignored)! nvme_feature_setting_arbitration.binnvme_feature_setting_lba_range_namespace_1.binnvme_feature_setting_temp_threshold.binnvme_feature_setting_error_recovery.binnvme_feature_setting_volatile_write_cache.binnvme_feature_setting_num_queues.binnvme_feature_setting_interrupt_coalescing.binnvme_feature_setting_interrupt_vec_config.binnvme_feature_setting_write_atomicity.binnvme_feature_setting_async_event_config.binnvme_feature_setting_sw_progress_marker.binFeature 0x%x data not retrieved, error %d (ignored)! Unsupported log page format version %d of log page : 0x%X Getting size of log page : 0x%X failed with %d zip -r "%s" "%s" >temp.txt 2>&1Failed to create log data package, %s! Failed to remove temporary files!Clear PCIe Device Correctable ErrorsDevice correctable errors cleared!Error clearing Device correctable errors = 0x%x setpci -s %x:%x.%x ECAP_AER+0x10.L=0xffffffffsetpci -s %x:%x.%x ECAP_AER+0x10.LERROR : Unsupported drive for vs-drive-info cmdERROR : drive-info opcode failed with 0x%x ERROR : identify_ctrl() failed with 0x%x Drive Hardware Version: %hhu.%hhu Boot Spec.Version: %hhu.%hhu Retrieve Smart or Extended Smart Health log for the given device Unable to retrieve smart log 0xFB for the driveUnsupported drive model for vs-smart-add-log commmandOCP SMART Cloud Health Log: 0xC0Unable to retrieve extended smart log 0xC0 for the driveRetrieve Firmware Activation history of the given driveonly normal format is supported currently Unsupported drive model for vs-fw-activate-history command Failed to retrieve fw activation history log, error: %x Unsupported fw activation history page: %x, version: %x No entries were found in fw activation history log unsupported entry ! version: %x with length: %d select/save values: enable/disable options1 - save (persistent), 0 - non-persistent and for status options: 0 - current, 1 - default, 2-savedEnable or Disable Controller telemetry log generationdrive doesn't support host/controller generated telemetry logssuccessfully set controller telemetry optionFailed to set controller telemetry optionsuccessfully disabled controller telemetry optionFailed to disable controller telemetry optionController telemetry option : %s Failed to retrieve controller telemetry optioninvalid option %s, valid values are enable,disable or status This option is not supported for specified drive1 - hottest component temperature, 0 - composite temperature (default) for enable option, 0 (current), 1 (default), 2 (saved) for status options1 - persistent, 0 - non-persistent (default)Enable/Disable/Get status of SMBUS option on controllersuccessfully enabled SMBus on driveFailed to enabled SMBus on driveSMBus status on the drive: %s (returns %s temperature) Failed to retrieve SMBus status on the driveSuccessfully disabled SMBus on driveFailed to disable SMBus on driveInvalid option %s, valid values are enable, disable or status __________________________________________________________________________________ | | | | | | | Firmware | Power | Power | Previous | New FW | Slot | Commit | Result Activation| On Hour | cycle | firmware | activated | number | Action | Counter | | count | | | | Type | __________|___________|_________|__________|___________|________|________|________ Physical Media Units Written - TLCPhysical Media Units Written - SLCNormalized Bad User NAND Block CountUncorrectable Read Error CountSSD End to End Corrected ErrorsSSD End to End Detected CountsSSD End to End Uncorrected CountsMinimum User Data Erase Count - TLCMaximum User Data Erase Count - TLCAverage User Data Erase Count - TLCMinimum User Data Erase Count - SLCMaximum User Data Erase Count - SLCAverage User Data Erase Count - SLCDataset Management (Deallocate) CommandsBackground Back-Pressure GaugeNormalized Bad System NAND Block CountRaw Bad System NAND Block CountWRITE CMDs exceeding thresholdTRIMs CMDs exceeding thresholdMicron vendor specific extensionsEnable/Disable SMBUS on the driveEnable/Disable controller telemetry log generationRetrieve Micron PCIe error statsRetrieve Micron temperature statistics Package Version******************** Drive Info ******************** PCI Info *check if tar and gzip commands acheck if zip command is installeERROR_INFORMATIONSMART_INFORMATIONFW_SLOT_INFORMATIONCHANGED_NAMESPACE_LISTDEVICE_SELF_TESTTELEMETRY_HOST_INITIATEDVS_MEDIA_SMART_LOGVS_DEBUG_LOG1VS_SEC_ERROR_LOG_PAGEVS_LIFE_TIME_DRIVE_HISTORYVS_EXTENDED_SMART_INFOVS_LIST_SUPPORTED_LOG_PAGEVS_POWER_MONITOR_LOG_PAGEVS_CRITICAL_EVENT_LOG_PAGEVS_RECENT_DRIVE_HISTORYVS_OEM2_REVISIONVS_PCIE_ERROR_LOG_PAGEVS_OEM2_WORK_LOADVS_OEM2_FW_SECURITYSoft ECC error countBad NAND block countPower On HoursPower Fail Event CountDevice Power Cycle CountRaw Read Error CountUn-KnownRefresh countUser data erase fail countSystem area erase fail countLSB of Flash GB erasedMSB of Flash GB erasedLIFETIME_DEV_SLEEP_EXIT_COUNTLIFETIME_ENTERING_PS4_COUNTLIFETIME_ENTERING_PS3_COUNTRetired block countProgram fail countSystem data % usedUnexpected power loss countWear range deltaPCIE_INTF_DOWNSHIFT_COUNTE2E_CRC_ERROR_COUNTMax lifetime temperatureRAIS_ECC_CORRECT_ERR_COUNTDRIVE_LIFE_PROTECTION_STATUSRemaining SSD lifeFree SpaceLSB of Trim countMSB of Trim countOP percentageMax lifetime SOC temperatureLogPage-NameLogPage-Id%-15s %-30s supported_log_pageslogpage_idlogpage_name0x%-15X%-20s : %u C Current PCB TemperatureCurrent SOC TemperatureHighest Temperature%-20s : %d C Max SOC TemperatureSuper-cap Current TemperatureSuper-cap Max TemperatureCurrent PCB temperatureCurrent SOC temperatureHighest temperatureMax SOC temperatureSuperCap Current temperatureSuperCap Max temperature%-45s : %u Cpl TLP Poisoned Error Count%-45s : %s Ext-Smart-ValueExt-Smart-IdDescription%-39s %-15s %-19s %-40s%-15dExtended-SMART-Attributesattribute_nameattribute_idattribute_valueSupercap Attributes%-39s %-19s Super-cap current temperatureSuper-cap maximum temperatureSuper-cap status 0x%016lx%016lxDRAM correctable error count%s: Write Failed dump-filedump fileDevice:%s namespace-id:%#x Block # :%d to %d log_specificseagateget-ctrl-teleget-host-televs-log-page-supCOMMANDS_SUPPORTED_AND_EFFECTSTELEMETRY_CONTROLLER_INITIATEDDRAM Supercap SMART AttributesSSD End to end correction countsThermal throttling status and countPCIe Uncorrectable Error countUncorrectable RAISE error countLSB of Physical (NAND) bytes writtenMSB of Physical (NAND) bytes writtenLSB of Physical (HOST) bytes writtenMSB of Physical (HOST) bytes writtenLSB of Physical (NAND) bytes readMSB of Physical (NAND) bytes readSeagate-Plugin version : %d.%d Retrieve Seagate Supported Log-Page information for the given device Seagate Supported Log-pages count :%d Retrieve Seagate Temperature Stats information for the given device Seagate Temperature Stats Information :Clear Seagate PCIe Correctable counters for the given device Retrieve Seagate PCIe error counters for the given device Seagate PCIe error counters Information :PCIe Un-Correctable Error CountUnexpected Completion Status(UCS)Completion Timeout Status (CTS)Data Link Protocol Error Status(DLPES)Replay Timer Timeout Status(RTS)Replay_NUM Rollover Status(RRS)Cpl TLP Unsupported Request Error CountCpl TLP Completion Abort Error CountRequest Completion Abort Error CountAdvisory Non-Fatal Error Status(ANFES)Retrieve Seagate Extended SMART information for the given device Seagate Extended SMART Information : Seagate DRAM Supercap SMART Attributes :Data units read to DRAM namespaceData units written to DRAM namespaceDRAM uncorrectable error countCapture the Telemetry Controller-Initiated Data in binary formatCapture the Telemetry Controller-Initiated Data in either hex-dump (default) or binary formatData Block 1 Last Block:%d Data Block 2 Last Block:%d Data Block 3 Last Block:%d 1 - controller shall capture Data representing the internal state of the controller at the time the command is processed. 0 - controller shall not update the Telemetry Host Initiated Data.Capture the Telemetry Host-Initiated Data in either hex-dump (default) or binary formatSeagate vendor specific extensionsShows Seagate plugin's version information Retrieve Seagate Controller-Initiated Telemetry in binary formatRetrieve Seagate Controller-Initiated Telemetry Retrieve Seagate Host-Initiated Telemetry Clear Seagate PCIe error statistics Retrieve Seagate PCIe error statistics Retrieve Seagate extended-SMART Information Retrieve Seagate Supported Log-pages Information Retrieve Seagate temperature statistics 877777 88`8888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888P808p7`7p88888p7`778887888888@878\85\8\8\85\8\8\8l6\86|66\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8566L7<7,77 77|7\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8l7\7\6L6<6\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8,66 655\8\85\8\8\8\8\855\8\8\85\8\8\8\8\8 87\8\87\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\8\877\877\8\8\8\8\8\87L8<8,88\8\8\8\86666seaget_d_raw "bit %u":"%ub %s" %s },Cannot open %s Log file: %s Cannot read identify deviceCannot read namespace-idCannot read device SMART logCannot malloc bufferlog;%s;%lu;%s;%s;%-.*s;Capacity;%lf;Critical_Warning;%u;Temperature;%u;Available_Spare;%u;Available_Spare_Threshold;%u;Percentage_Used;%u;Data_Units_Read;%0.Lf;Data_Units_Written;%0.Lf;Host_Read_Commands;%0.Lf;Host_Write_Commands;%0.Lf;Controller_Busy_Time;%0.Lf;Power_Cycles;%0.Lf;Power_On_Hours;%0.Lf;Unsafe_Shutdowns;%0.Lf;Media_Errors;%0.Lf;Num_Err_Log_Entries;%0.Lf;Warning_Temperature_Time;%u;Temperature_Sensor_%d;NC;Temperature_Sensor_%d;%d;NandWrites;%d; run-timefreqtest-nameNAME%Y-%m-%dRunning...Running for %lf hour(s) Cannot update driver logHMAC SHA-2561 = supports reservations00b = SGLs are not supported11b = Reserved "PCI Vendor ID":"%sh", "Serial Number":"%s", "Model Number":"%s", "Value":"%sh", "Controller ID":"%sh", "Version":"%sh", "Controller Attributes":{ "Firmware Updates":{ "Log Page Attributes":{ "Total Size":"%u", "Access Size":"%u", "Sanitize Capabilities":{ "Maximum Size":"%u", } "Format NVM Attributes":{ "Volatile Write Cache":{ "SGL Support":{ "bit 1:0":"%s", "Power State Descriptors":{ "ACTP":"Active Power," "MP":"Maximum Power," "IDLP":"Idle Power," "Ofs":"BYTE Offset,"MPSNOPS0fs 00-03ACTPAPWAPS0fs 20-23IDLPIPS0fs 16-19RRTRRLRWTRWL0fs 12-15EXLATENLAT=========%6d%9sh%4ub%3ub%5sh%3sh%3sb%u%u%u%4sb "} } {"Vendor Specific":"[%08X] %02X [%08lX] "}virtiumshow-identifysave-smart-to-vtview-logCannot read device firmware logheader;{"session":{"testName":"%s","dateTime":"%s"},"devices":[{"model":"%s","port":"%s","SN":"%s","type":"NVMe","identify":"%s","firmwareSlot":"%s"}]} Cannot read namespace identifyCannot read device identify controllerCritical_Composite_Temperature_Time;%u;Thermal_Management_T1_Trans_Count;%u;Thermal_Management_T2_Trans_Count;%u;Thermal_Management_T1_Total_Time;%u;Thermal_Management_T2_Total_Time;%u;(optional) Number of hours to log data (default = 20 hours)(optional) How often you want to log SMART data (0.25 = 15' , 0.5 = 30' , 1 = 1 hour, 2 = 2 hours, etc.). Default = 10 hours.(optional) Name of the log file (give it a name that easy for you to remember what the test is). You can leave it blank too, we will take care it for you.(optional) Name of the test you are doing. We use this as part of the name of the log file.Save SMART data into log file with format that is easy to analyze (comma delimited). Maximum log file will be 4K. Typical usages: Temperature characterization: virtium save-smart-to-vtview-log /dev/yourDevice --run-time=100 --record-frequency=0.25 --test-name=burn-in-at-(-40) Endurance testing : virtium save-smart-to-vtview-log /dev/yourDevice --run-time=100 --record-frequency=1 --test-name=Endurance-test-JEDEG-219-workload Just logging : virtium save-smart-to-vtview-log /dev/yourDeviceError parse and open (fd = %d) Collecting data for device %s Logging SMART data for every %lf hour(s) Parse identify data to json format Typical usages: virtium show-identify /dev/yourDevice 0 = the NVM subsystem contains only a single NVM subsystem port1 = the NVM subsystem may contain more than one subsystem ports0 = the NVM subsystem contains only a single controller1 = the NVM subsystem may contain two or more controllers (see section 1.4.1)0 = the controller is associated with a PCI Function or a Fabrics connection1 = the controller is associated with an SR-IOV Virtual Function0 = does not support sending the Namespace Attribute Notices event nor the associated Changed Namespace List log page1 = supports sending the Namespace Attribute Notices & the associated Changed Namespace List log page0 = does not support sending Firmware Activation Notices event1 = supports sending Firmware Activation Notices0 = does not support a 128-bit Host Identifier1 = supports a 128-bit Host Identifier0 = does not support Non-Operational Power State Permissive Mode1 = supports Non-Operational Power State Permissive Mode0 = does not support the Security Send and Security Receive commands1 = supports the Security Send and Security Receive commands0 = does not support the Format NVM command1 = supports the Format NVM command0 = does not support the Firmware Commit and Firmware Image Download commands1 = supports the Firmware Commit and Firmware Image Download commands0 = does not support the Namespace Management capability1 = supports the Namespace Management capability0 = does not support the Device Self-test command1 = supports the Device Self-test command0 = does not support Directives1 = supports Directive Send & Directive Receive commands0 = does not support the NVMe-MI Send and NVMe-MI Receive commands1 = supports the NVMe-MI Send and NVMe-MI Receive commands0 = does not support the Virtualization Management command1 = supports the Virtualization Management command0 = does not support the Doorbell Buffer Config command1 = supports the Doorbell Buffer Config command0 = the 1st firmware slot (slot 1) is read/write1 = the 1st firmware slot (slot 1) is read only0 = requires a reset for firmware to be activated1 = supports firmware activation without a reset0 = does not support the SMART / Health information log page on a per namespace basis1 = supports the SMART / Health information log page on a per namespace basis0 = does not support the Commands Supported & Effects log page1 = supports the Commands Supported Effects log page0 = does not support extended data for Get Log Page1 = supports extended data for Get Log Page (including extended Number of Dwords and Log Page Offset fields)0 = does not support the Telemetry Host-Initiated and Telemetry Controller-Initiated log pages and Telemetry Log Notices events1 = supports the Telemetry Host-Initiated and Telemetry Controller-Initiated log pages and sending Telemetry Log Notices0 = the format of all Admin Vendor Specific Commands are vendor specific1 = all Admin Vendor Specific Commands use the format defined in NVM Express specification0 = does not support autonomous power state transitions1 = supports autonomous power state transitions0 = the NVM subsystem supports one device self-test operation per controller at a time1 = the NVM subsystem supports only one device self-test operation in progress at a time0 = does not support host controlled thermal management1 = supports host controlled thermal management. Supports Set Features & Get Features commands with the Feature Identifier field set to 10h0 = does not support the Crypto Erase sanitize operation1 = supports the Crypto Erase sanitize operation0 = does not support the Block Erase sanitize operation1 = supports the Block Erase sanitize operation0 = does not support the Overwrite sanitize operation1 = supports the Overwrite sanitize operation0 = does not support the Compare command1 = supports the Compare command0 = does not support the Write Uncorrectable command1 = supports the Write Uncorrectable command0 = does not support the Dataset Management command1 = supports the Dataset Management command0 = does not support the Write Zeroes command1 = supports the Write Zeroes command0 = does not support the Save field set to a non-zero value in the Set Features and the Get Features commands1 = supports the Save field set to a non-zero value in the Set Features and the Get Features commands0 = does not support reservations0 = does not support the Timestamp feature (refer to section 5.21.1.14)1 = supports the Timestamp feature0 = does not support the Compare and Write fused operation1 = supports the Compare and Write fused operation0 = supports format on a per namespace basis1 = all namespaces shall be configured with the same attributes and a format (excluding secure erase) of any namespace results in a format of all namespaces in an NVM subsystem0 = any secure erase performed as part of a format results in a secure erase of a particular namespace specified1 = any secure erase performed as part of a format operation results in a secure erase of all namespaces in the NVM subsystem0 = cryptographic erase is not supported1 = cryptographic erase is supported as part of the secure erase functionality0 = a volatile write cache is not present1 = a volatile write cache is present0 = the format of all NVM Vendor Specific Commands are vendor specific1 = all NVM Vendor Specific Commands use the format defined in NVM Express specification01b = SGLs are supported. There is no alignment nor granularity requirement for Data Blocks10b = SGLs are supported. There is a Dword alignment and granularity requirement for Data Blocks "PCI Subsystem Vendor ID":"%sh", "Firmware Revision":"%-.*s", "Recommended Arbitration Burst":"%sh", "IEEE OUI Identifier":"%sh", "Controller Multi-Path I/O and Namespace Sharing Capabilities":{ "Maximum Data Transfer Size":"%sh", "RTD3 Resume Latency":"%sh", "RTD3 Entry Latency":"%sh", "Optional Asynchronous Events Supported":{ "FRU Globally Unique Identifier":"%sh", "NVMe Management Interface Specification":"%sh", "Optional Admin Command Support":{ "Abort Command Limit":"%sh", "Asynchronous Event Request Limit":"%sh", "Firmware Slot":"%uh", "Error Log Page Entries":"%sh", "Number of Power States Support":"%sh", "Admin Vendor Specific Command Configuration":{ "Autonomous Power State Transition Attributes":{ "Warning Composite Temperature Threshold":"%sh", "Critical Composite Temperature Threshold":"%sh", "Maximum Time for Firmware Activation":"%sh", "Host Memory Buffer Preferred Size":"%sh", "Host Memory Buffer Minimum Size":"%sh", "Total NVM Capacity":"%sh", "Unallocated NVM Capacity":"%sh", "Replay Protected Memory Block Support":{ "Number of RPMB Units":"%u", "Authentication Method":"%u: %s", "Extended Device Self-test Time":"%sh", "Device Self-test Options":{ "Firmware Update Granularity":"%sh", "Keep Alive Support":"%sh", "Host Controlled Thermal Management Attributes":{ "Minimum Thermal Management Temperature":"%sh", "Maximum Thermal Management Temperature":"%sh", "Submission Queue Entry Size":{ "Required Size":"%u", "Completion Queue Entry Size":{ "Maximum Outstanding Commands":"%sh", "Number of Namespaces":"%sh", "Optional NVM Command Support":{ "Fused Operation Support":{ "Atomic Write Unit Normal":"%sh", "Atomic Write Unit Power Fail":"%sh", "NVM Vendor Specific Command Configuration":{ "Atomic Compare 0 Write Unit":"%sh", "NVM Subsystem NVMe Qualified Name":"%s", "NOPS":"Non-Operational State," "MPS":"Max Power Scale (0: in 0.01 Watts; 1: in 0.0001 Watts)," "ENLAT":"Entry Latency in microseconds," "RWL":"Relative Write Latency," "RRL":"Relative Read Latency," "IPS":"Idle Power Scale (00b: Not reported; 01b: 0.0001 W; 10b: 0.01 W; 11b: Reserved)," "APS":"Active Power Scale (00b: Not reported; 01b: 0.0001 W; 10b: 0.01 W; 11b: Reserved)," "EXLAT":"Exit Latency in microsecond," "RWT":"Relative Write Throughput," "RRT":"Relative Read Throughput," "APW":"Active Power Workload," "Power State Descriptors":"%6s%10s%5s%4s%6s%10s%10s%10s%4s%4s%4s%4s%10s%4s%6s%10s%4s%5s%6s 0 = does not support the Keyed SGL Data Block descriptor1 = supports the Keyed SGL Data Block descriptor0 = the SGL Bit Bucket descriptor is not supported1 = the SGL Bit Bucket descriptor is supported0 = use of a byte aligned contiguous physical buffer of metadata is not supported1 = use of a byte aligned contiguous physical buffer of metadata is supported0 = the SGL length shall be equal to the amount of data to be transferred1 = supports commands that contain a data or metadata SGL of a length larger than the amount of data to be transferred0 = use of Metadata Pointer (MPTR) that contains an address of an SGL segment containing exactly one SGL Descriptor that is Qword aligned is not supported1 = use of Metadata Pointer (MPTR) that contains an address of an SGL segment containing exactly one SGL Descriptor that is Qword aligned is supported0 = the Address field specifying an offset is not supported1 = supports the Address field in SGL Data Block, SGL Segment, and SGL Last Segment descriptor types specifying an offsetVirtium vendor specific extensionsShows detail features and current settingsPeriodically save smart attributes into a log file. The data in this log file can be analyzed using excel or using Virtium’s vtView. Visit vtView.virtium.com to see full potential uses of the dataPut the name of ./vtView-Smart-leA4@$@ @hex feature name (required)hexadecimal feature nameshannonset-feature-addget-feature-addModify the saveable or changeable current operating parameters of the controller. Operating parameters are grouped and identified by Feature Identifiers. Feature settings can be applied to the entire controller and all associated namespaces, or to only a few namespace(s) associated with the controller. Default values for each Feature are vendor-specific and may not be modified.Use get-feature to determine which Features are supported by the controller and are saveable/changeable. Available additional feature id: 0x02: Shannon power management failed to read data buffer from input file [0-3]: curr./default/saved/supp.Read operating parameters of the specified controller. Operating parameters are grouped and identified by Feature Identifiers; each Feature Identifier contains one or more attributes that may affect behaviour of the feature. Each Feature has three possible settings: default, saveable, and current. If a Feature is saveable, it may be modified by set-feature. Default values are vendor-specific and not changeable. Use set-feature to change saveable Features. Available additional feature id: 0x02: Shannon power management Get Shannon vendor specific additional smart log (optionally, for the specified namespace), and show it.key normalized valueprogram_fail_count : %3d%% %lu erase_fail_count : %3d%% %lu wear_leveling : %3d%% min: %u, max: %u, avg: %u end_to_end_error_detection_count: %3d%% %lu crc_error_count : %3d%% %lu timed_workload_media_wear : %3d%% %.3f%% timed_workload_host_reads : %3d%% %lu%% timed_workload_timer : %3d%% %lu min thermal_throttle_status : %3d%% CurTTSta: %u%%, TTCnt: %u retry_buffer_overflow_count : %3d%% %lu pll_lock_loss_count : %3d%% %lu nand_bytes_written : %3d%% sectors: %lu host_bytes_written : %3d%% sectors: %lu sram_error_count : %3d%% %lu Shannon vendor specific extensionsShannon NVMe Identify ControllerSet a Shannon feature and show the resulting valueGet Shannon feature and show the resulting valueRetrieve Shannon SMART Log, show itCriticalWarningGet the Dera device statusQuick RebuildingFull RebuildingRaw RebuildingCard Read OnlyFatal ErrorBusyLow Level FormatFirmware CommittingOver TemperatureInitial LowRuntime Low NVMe status:%s(0x%x) deradevice_status : %s %d%% completed device_status : %s dev_status_up : %s cap_aged : %s cap_aged_ratio : %d%% cap_status : %s cap_voltage : %d mV nand_erase_err_cnt : %d nand_program_err_cnt : %d ddra_1bit_err : %d ddra_2bit_err : %d ddrb_1bit_err : %d ddrb_2bit_err : %d ddr_err_bit : %d pcie_corr_err : %d pcie_uncorr_err : %d pcie_fatal_err : %d power_level : %d W current_power : %d mW nand_init_fail : %d fw_loader_version : %.*s uefi_driver_version : %.*s pcie_volt_status : %s pcie_volt_status : Unknowncurrent_pcie_volt : %d mV init_pcie_volt_low_cnt : %d rt_pcie_volt_low_cnt : %d temp_sensor_abnormal_cnt : %d nand_read_retry_fail_cnt : %d fw_slot_version : %.*s Dera vendor specific extensionsRetrieve Dera SMART Log, show itMajor Revision : %u Minor Revision : %u Bucket %2d: %u Group 4: Range is 1s-2s: Group 5: Range is 2s-4s: Group 6: Range is 4s+:vu ioctl fail, errno %d Confirm Y/y, Others cancel: Cancled. Sending operation ... ATOMICUPDATE_PROVISION_CAPACITYIoctl Fail.ScaleFlux clean card successInvalid Param ScaleFlux-set-featureraid_recover_cntprog_timeout_cnterase_timeout_cntread_timeout_cntread_ecc_cnt/ncap size in GBcap-bytecap size in byte%dG %luB %lu 4K sfx-change-capNVMe IO command error:%s(%x) ScaleFlux-get-featuremalloc fail, errno %d get-bad-blockBad Block Table MF_BB_COUNT: %u GROWN_BB_COUNT: %u TOTAL_BB_COUNT: %u REMAP_MFBB_COUNT: %u REMAP_GBB_COUNT: %u REMAP_MFBB_TABLE [ 0x%lx ]REMAP_GBB_TABLE [sfxGet a featureSet a featureDynamic change capacityquery-capQuery current capacity infoGet ScaleFlux Latency Statistics log and show it. ScaleFlux IO %s Command Latency Statistics Group 1: Range is 0-1ms, step is 32us Group 2: Range is 1-32ms, step is 1ms Group 3: Range is 32ms-1s, step is 32ms:query current capacity info of vandalogic capacity:%5lluGB(0x%lx) provisioned capacity:%5lluGB(0x%lx) free provisioned capacity:%5lluGB(0x%lx) used provisioned capacity:%5lluGB(0x%lx) WARNING: %s. Use the force [--force] option to suppress this warning. ScaleFlux internal set features feature id 1: ATOMIC value 0: Disable atomic write 1: Enable atomic writeGoing to clean device's data, confirm umount fs and try againError: requesting clean card on non-controller handle NVMe Admin command error:%s(%x) Please change-sector size to 4K, then retryChanging physical capacity may irrevocably delete this device's dataScaleFlux set-feature:%#02x (%s), value:%d Get ScaleFlux vendor specific additional smart log (optionally, for the specified namespace), and show it.Additional Smart Log for ScaleFlux device:%s namespace-id:%x thermal_throttle_status : %3d%% %u%%, cnt: %u raid_recover_cnt : %3d%% %lu read_ecc_cnt : %3d%% %lu prog_timeout_cnt : %3d%% %lu erase_timeout_cnt : %3d%% %lu read_timeout_cnt : %3d%% %lu change-cap query mem info failWARNING: Free memory is not enough! Please drop cache or extend more memory and retry WARNING: Memory needed is %lu, free memory is %lu ScaleFlux change-capacity: failChanging Cap may irrevocably delete this device's dataScaleFlux change-capacity: successWARNING: Only support 1.0~4.0 x provisoned capacity! WARNING: The target capacity is less than 1.0 x provisioned capacity! WARNING: The target capacity is larger than 4.0 x provisioned capacity! ScaleFlux internal set features feature id 1: ATOMICScaleFlux get-feature:%02x (%s), value:%d Get bad block table of sfx block device.ScaleFlux get bad block table: successScaleFlux vendor specific extensionsRetrieve bad block table of block device, show itRetrieve ScaleFlux IO Latency Statistics log, show itRetrieve ScaleFlux SMART Log, show itGet nvme bad block number.Get nvme health percentage.Transcend NVME heath value: 0%% %d%% transcendbadblockGet NVME bad block numberhealthvalueNVME health percentageTranscend NVME badblock count: %d Transcend vendor specific extensionsNamespace identifier to usezns changed-zone-listzslbastarting LBA of the zonefile containing data to writepiremapAppend size not provided Invalid value for prinfo:%#x read-metadatazns zone-appendNo memory for data size:%lx zns identify namespacezns set-zone-descselect-allsend command to all zoneszsazone send actionZone Management Sendzns zone-mgmt-sendstate of zones to listshow report zones verbosityextendedpartialset to use the partial reportzns report-zonesnr_zones: %lu zraZone Receive Actionzrasflength of data in bytesZone Management Receivezns zone-mgmt-recvzns identify controllerOffline zones Reset zones Open zones Finish zones Close zones znsZoned Namespace Command Setoffline-zoneOfflines one or more zonesreset-zoneResets one or more zonesopen-zoneOpens one or more zonesfinish-zoneFinishes one or more zonesclose-zoneCloses one or more zonesRetrieve Changed Zone log for the given devicefile with metadata to be writtenlogical block application tag mask (for end to end PI)logical block application tag (for end to end PI)protection information action and checks fieldprotection information remap (for type 1 PI)The zone append command is used to write to a zone using the slba of the zone, and the write will be appended from the write pointer of the zoneData size:%#lx not aligned to lba size:%#x Metadata size:%#lx not aligned to metadata size:%#x latency: zone append: %llu us Success appended data to LBA %lx No memory for metadata size:%d starting LBA of the zone for this commandoptional file for zone extention data (default stdin)Set Zone Descriptor Extension zone format does not provide descriptor extention could not alloc memory for zone descset-zone-desc: Success, zone:%lx nsid:%d optional file for data (default stdin)zone send action must be specified Zone Descriptor Extensions are not supported data, data_len only valid with set extended descriptor zone-mgmt-send: Success, action:%d zone:%lx all:%d nsid:%d number of descriptors to retrieve (default: all of them)set to use the extended report zonesRetrieve the Report Zones data structureZone Receive Action Specific Field(Reporting Options)Zone Receive Action Specific Features(Partial Report)error: data len is needed for NVME_ZRA_ZONE_REPORT could not alloc memory for zone mgmt receive datazone-mgmt-recv: Success, action:%d zone:%lx nsid:%d Send an ZNS specific Identify Namespace command to the given device and report information about the specified namespace in varios formats.Send an ZNS specific Identify Controller command to the given device and report information about the specified controller in various formats.%s: Success, action:%d zone:%lx all:%d nsid:%d Retrieves the changed zone list logWrites data and metadata (if applicable), appended to the end of the requested zoneAttaches zone descriptor extension dataRetrieve the Report Zones reportSends the zone management send commandSends the zone management receive commandRetrieve ZNS namespace identificationRetrieve ZNS controller identification0x%04x%04x%04xjson_rpc_2_0_verjson_rpc_2_0_ver : %s nvidiaNVIDIA vendor specific extensionsymtcGet Ymtc vendor specific additional smart log (optionally, for the specified namespace), and show it.thermal_throttle_status : %3d%% %lu%%, cnt: %lu nand_bytes_read : %3d%% %lu tempt_since_born : %3d%% max: %u, min: %u, curr: %u power_consumption : %3d%% max: %u, min: %u, curr: %u tempt_since_bootup : %3d%% max: %u, min: %u, curr: %u power_loss_protection : %3d%% %lu read_fail : %3d%% %lu thermal_throttle_time : %3d%% %lu flash_error_media_count : %3d%% %lu Ymtc vendor specific extensionsRetrieve Ymtc SMART Log, show it"'])};:,arg --%s[=<%s>]=<%s> -%c [<%s>] <%s>--- Usage: %s Options:r+Error Parsing Sub-Options Unable to open %s file: %s %s out of range failed to allocate memory for opts: %s Expected integer argument for '%s' but got '%s'! Expected 0 or 1 argument for '%s' but got '%s'! Expected byte argument for '%s' but got '%s'! Expected short argument for '%s' but got '%s'! Expected word argument for '%s' but got '%s'! Expected long integer argument for '%s' but got '%s'! Expected long suffixed integer argument for '%s' but got '%s'! Expected float argument for '%s' but got '%s'! Error Parsing Sub-Options: Too many options! PiTiGiMiKiPPPPPPPPPPPPPP0PP%6ld.%06ld%ld%s%s%s: %s<%s>%s %s<%s> %s: [%s] %s%s [%s]%s %s: [%s] <%s>%s [%s] <%s> %s: Allocation of memory for json object failed, aborting. (null)\""%s" : %lld%llu%.0Lfl|dD;~L{,T^9<\+܊pmmdo 4r0},P<0L\l,|4̋p܋Ч|l\l\|܎0D\dlx| <LH\tl,\\L,T dL?,j?l?n4@q@ls@u@u@|A\BlC\CCClDDXD xD̛D DLE|lE E\FFF\GlGllHH,H\HHI$I8ILIpIIII]>]l?]?]\Ed^U_\]P_i_r_v0`,x|`x`,y`,a|a(b܌b܍bb $c`c\cܐcc<d̒ FBB A(A0J'\Ak\Bj[Bk[Al\Ak_Ah_Bo^BhWAocA 0A(A BBBK pBIPFADDWADDWBDDE|.hEFEB B(A0A8Dp 8A0A(B BBBJ ^ 8D0A(B BBBE p 8A0A(B BBBA Lt/IYFBB B(A0A8J 8A0A(B BBBE /NH/P\/QEJ r AF d AC t AK ` AG ` AG n AA ` AG hAL0 SM`0\SOER I j0S08W5Lb`0`W7FBB E(A0A8G@ 8D0A(B BBBI l8A0A(B BBB`1<[%FBB B(A0A8GP 8D0A(B BBBJ o 8A0A(B BBBG Tt1aNEM G(H0A8H@ 8A0A(B BBBA E1@bKFBB B(A0A8G@G 8A0A(B BBBJ DHMPhHA@K 8L0F(B BBBI g 8A0A(B BBBE  8H0A(B BBBE  8H0A(B BBBE 2d6Ee02d FAA D`  AABD 2p FEB B(A0D8DpWxJp 8A0A(B BBBF p 8A0A(B BBBF  8H0A(B BBBE 8d3(}IAA n ABD  ABG 3} FBB B(A0A8GrOOORHOIBIBAAUO]ABBeB 8A0A(B BBBH DTOOYVJAI t4Dq K f J W4d%EL G H4t%EL G H4%EL G H42Ec H A5 ,5@5 T5ȈED` AA x5H` A 5hH` A 5H` A 5H` A 5TsH`e A 6cH`U A  6 H`{ A <<6FEE D(G0S (A BBBA |6H`  A H6FEE E(D0H8HPq 8D0A(B BBBA 6H A 7H A 7Hp A 874H`s A T7|H`n A p7 7G7D7P27|7778$888ĒL8В`8ܒt8888 8 8$EP` AA (81HNE B(B0B8F@I\(9FIE B(E0C8DPrXV`BhBpBxBUPH8A0A(B BBB`9DHLL J(B0B8B@ID C AO J(B0B8B@ID C AL J(B0B8B@ID9+HO S:(HO P$:(HI V(@:0HJL B(B0B8B@Il:#HL N(:Ԕ/HJF G(B0B8B@I:ؔ%HI S:(HL S:%HL P;"HI P$;('HN P(@;<3HJO B(B0B8B@Il;P&HJ S;d&HM P;x&HJ S;&HJ S;%HL P;&HJ S<ȕ%HL P 0<ܕEH` AA T<h1 h<EK` AH @< 6FBB D(D0DP 0A(A BBBB <H`x H <:HNG N(B0L=S` A $,=` EG I  AA T=HsH`e A p=K I  A =l}H`o A =ЛE_`a AA =<H` A =H` A >DH` A $>H` A @><EH` AA d>؞EH` AA >tEY`h AA >\`y A >dnH`` A >EK`h AA ?H` A $?H` A @?,$T?8ERp AA H|?BBB B(A0A8G 8A0A(B BBBD ?dKADp AC `?BGE I(A0JDF^AbQQAw 0A(A BBBA <P@̦BBA A(G I  (A ABBD L@.FIG E(D0A8G[ 8A0A(B BBBD H@|(BGE J(A0C8D` 8A0A(B BBBJ 8,A`BJL N(B0B8B@I @ ABA 8hABMJ N(B0B8B@I s ABD AX Ad ApFBB B(A0A8G L%%J&Q&H&^%R%j&K%B%[%t&U%A%e%P&P%A% 8A0A(B BBBG 8%e&E&D&I%p%l&G%B%U%E&F%A%%[&F&B&I%%E&H%A%%M&O&H&M%,B`AAG I v AAF 8 CFED A(Dp (A ABBK LHC2FBA A(G I  W P A m (A ABBI <C"FBA A(G I  (A ABBE HCTFEE E(A0D8G 8A0A(B BBBG ($DEDDPl AAE @PD,FEE D(C0D` 0A(A BBBG DtH`f A LDl( FBB B(A0A8G I _ 8A0A(B BBBI TEL1FEH B(D0C8GHAPCXG`I@ 8D0A(B BBBE PXE4FBB B(A0A8G I! 8A0A(B BBBK TE%FBB B(A0A8G I!< 8A0A(B BBBD FDF:At04FBOA Gl  AABG hFyADPc AG $F=AAD tAA(F(LAIZ ^ AAA 0FLOANN(G0M(A S AAA HGhLLQ R AAC D(J0](A QCAGA 4`GBKA t ABK ~ABGG q(GuAGG AAF GAG AH H| `$HFBE F(G0D8D@g 8D0A(B BBBJ D 8H0A(B BBBE $HAND DALH;BBB B(A0A8G I! 8A0A(B BBBD LI|rBSJ B(A0A8Fb 8A0A(B BBBK 8PI3BBK A(D@ (A ABBD (IEFG AAA I4xER J AF I)HN J DLIFBB B(A0A8Dl 8A0A(B BBBH zPLRx}  P$RFBB B(A0D8GU 8A0A(B BBBI ,zPLRx)}  4,+QLKXBBB B(A0A8G I n 8A0A(B BBBF PXKW FBB B(A0A8G L.p 8A0A(B BBBE 8K FAA G L*2  AABG LKFML B(A0A8N 8A0A(B BBBF H8LtxFKH B(A0A8Db 8A0A(B BBBC HLBGF D(D0B (C ABBG u(C ABBL CLH FKE B(K0A8N 8A0A(B BBBK cVA{OHFL HJ  8A0A(B BBBD MK\H HL  HE  HE Mx$FdM$:FKB B(A0D8D@n 8A0A(B BBBJ L 8J0F(B BBBL p0N&FBB B(A0D8G@NPA 8A0A(B BBBG GNRAN8*qOH8N+FBA C(DP (A ABBA (O+zECD0f AAA 8,O+FBA C(DP (A ABBA (hOT,EAD0 AAA (O,wECD0c AAA 0O-FAA D@  AABE $O-ADD AA$P .AAG uAA0DP.BMD D0  AABA xP/@P/ZBBA A(G L% (A ABBE LP2BBB B(A0A8G 8A0A(B BBBG 0 Q 6xFNM G  AABH (TQX7ENK0l AAD LQ9 FBE B(A0A8G] 8A0A(B BBBA $QDAEDD mAA8QDFNA D(G (A ABBF (4RhFEHD@ AAH 0`RGFAA G  AABJ RH]FBB B(A0A8G L%r%F%F%F%F%F%F%F%F%I%I%I%I%I%e%q 8A0A(B BBBA $SXJ <FNI A(A0NCXA 0A(A BBBE tTvFBB B(A0A8G L@LEhEIEQEAEECEUEAE 8A0A(B BBBH L̑FNA A(N}H]A (A ABBE L@sFBB A(A0G L@LC 0A(A BBBC <lpCFBA A(G L! (A ABBC dBIE K(I0JHPDQ 0A(A BBBE dTXA(<PdxT4EMU@`HHPHHA@o AAG ؓ`,| FBB B(A0A8G L@LBB\BJBAB\ 8A0A(B BBBH xBIBIBIBIBIBTBhxBBE E(D0A8DP] 8F0A(B BBBE V 8A0A(B BBBH D8F0A(B BBBD H,@@FBB B(D0C8F@ 8A0A(B BBBH 4x4ZBAA G I   AABE $\yEKN XAALؕy FEB E(A0A8Dd 8A0A(B BBBA (%H<1FBB B(A0A8D`v 8A0A(B BBBF HFBB B(A0A8DPv 8A0A(B BBBF ԖA]{}@(FBB D(A0G@ 0A(A BBBB @lBHE H(D0D@} 0A(A BBBD H eFBB B(D0A8Dp~ 8A0A(B BBBC 0<$H8T$L=EAD mDA,t<FDA mABXtN $FBB D(A0J 0A(A BBBE wPA(zPLRx.  0!\ (AAULx BBA A(L0 (A ABBA ^ (D ABBA șt 8Av VAD K E &HX A  $4 MEDD vDA(\ bAW H M K M K M(T \FDA FDB< oFED A(D) (A ABBE 4PFAD G  AABH H,FBI L(D0C8DP 8F0A(B BBBF xKIB B(D0A8D@ 8F0A(B BBBF O 8H0A(B BBBH cHLPN8A0A(B BBBA@H 8A0A(B BBBN pD,eFEE E(H0H8G@n8A0A(B BBBtYW!%\!!  !@!! ! !  0@P`pО@*GH8HpHHIIJJJ{ -19J{(KhKKLXL{@]l.6@IWbgoϑIyuWԀYHƀ͇K T ^ j u   { 8 *8*o0h * * (l oooooz*pЎ 0@P`pЏ 0@P`pА 0@P`pБ 0@P`pВ 0@P`pГ 0@P`pД 0@P`p9k ib9*** ******`*@* ******`*@* ******`*@* ******`*@* ******`*@* ******`*@* ******`*@* ******`*@* ******`*@* ******`*@* ******Hh:b:0Db:pH:I@;ШIp;`bbbbcpc(8Hc;Сc&cAc;EKcUcqcc3Jcpc <0G\Kc\L@<кch<L<pv < 5-<P5wY =5LP=`cx=W=@c= Ic>c@> dp> d>P&d>L5d?Q@?Cdp?COd?pCzQ^dR?td7}0@0ESX@S@ @ d@Qd ApRdHAP] AdA`TdAXdBYd8B[dpB _ eBpc#eBf7eChb8C j:EekG_aen{eepe`CreeptTC` QCPeCPe DeXD eD@eDfDuf(Exf`Ey%fE{-fE}7fF @f8FQfhF`fFrfF`~f(Gf`GfGKfGvff@ff`H Xp ʁՁUFlVЧ\`***`*@* ****al0 zX vff`\* *vff@KP\******`*@* ***m|Pիܫ ȳT@Kf(}t P`@ +\`****`*@* ****4D T/eb0-@4p`  Pl00xe30xc0Dummy PlaceholderArbitrationPowerMgmntLbaRangeTypeTempThresholdErrorRecoveryVolatileWriteCacheNumOfQueuesInterruptCoalesing InterruptVectorConfig WriteAtomicity AsynEventConfig AutonomousPowerStateT * ******`*@* ******`*@* ******`*@* ****U $;TP q 28U XU xU PMYoP0  1FW@lU ! &@vf0HHWfu P  ] ^ \***vf] M`^ POW` (c \ *`*@*^` k` Z` ` fe e \* ++*lPi pe re z ؍  .r Lr ( H h  ?{ ؎  ( P x _r }r r r r {B{ r r Џ {,   mS43{s  s 8 X {{s >s Ls 3.r    Lr ( h H ?,is s mS{s s {s {{4Bs s  {.s >s s t 2 ,t Bt _t x \ + + + + + + +` +@ + + + + + + +` +@ +ft Poq pvt 02t t pt ;t Et t @u 0XU Ȑ .u lCu  Њ( P \ + + + + +` +@ + + + +E H   Ȣ `l  H  x    {{{{{{{{{{{{{{{{{{{{{{{{{{@ x P  P ѱ  \+++ٱ 8 ) h $ \@+++++vf G G  KlH PPM  \@+`+l( pTQV P \++++`+@+ ++] Z px h `* v s ] x z Zl `em \ +`+@+w } ~  \++++`+@+ ++++++`+@+- @  h      , 6 @N Z `u   s  V 8 pKfh pvf  \ +@+vff  \++l __end_default__I2 (    I4&k CwmB] eAz .A s @@.L?IMbP?o ư>by& .> -q=3 V瞯<[GA$3a18? GA$3p11130GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*0 GA*GOW*GA$3a1@ GA$3p1113GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA* GA*GOW* GA*FORTIFY8GA+GLIBCXX_ASSERTIONS GA*FORTIFYGA+GLIBCXX_ASSERTIONSnvme-1.16-10.el8_10.x86_64.debugA7zXZִF!t/v]?Eh=ڊ2N)ύ.h/KuWvGqf6(cM9c7L gCڥO5nwd]c: >JK-j [^ _@v29`ŗ"q JRAz__xN75+c#9 \Bؼ \'`%m]^A: )0gBUsA~g>/$ȉL颲0ELeb+TҮ%q=vT\@h`b'4ZKR<̎fӌf XGLUsSQtC~&K0ĵtMß+A 1DWLb|\폃yYD[Kw[=QSoQ.>&K25BԬE}^#mq ҐhxV ~mVmgX:h82Ȭ|ֽے,&(1YMFE*gnzW5S!^WwZ<X~t gV4-49B lF2kiL{.0|7};at,=CdoﻷX!W|y;h^,M5pE9s.E 'OT8I1}pV,pb~oi `* LJ[.es_ 5Nl, ")πM1Sv%Rž~_jSA3x3B@@EkK_h-"N4@WelaHQY͈sAN RD:cg󕏔`"`,PSI.Jߚ%ɶֲC}Y,ڙ {ST]3A(L̃ uF Ȩ1^cya~RXM[S JTSȢzkteQ,8|w'LfD9c0C6- 2 "l#1zDֿrr摩6OIX-XlHHJh*ta69Ys5^\85dd < JħF EgJ)Eo`!7)L(5BkI{*n>ueF +oFD c{I!_= T}h :b .͉ؤsR=y.ɮ8( D 26tvy!R?V^IJr[М.vg~ŶəuJI|\D!u k5tf尣I5QjWcUC!n:DH19g8@$]g>X XBicHͨ[ҋrXj958' $7Zf Ua?p(4|nn10kgVfaa@HpIit գ.Gqր5lw\8ބG0 FuF AfdY))zۤ z#E/Ϳ{XhpX#wB4AXU;ÆȜ#8rOu n&>GȉkqJd I@!J q(..%淉Sl.vr!9x571JRw+)fRI?{+pۤp33.]BYV1:&LQl#꘳ .3*koס1ҜHE~i<(VL%i4Gt)bZdWh{HFL򭥜ïd^ F}';wKrddZė.yO\^KHK6%QT'MeZ \U4~O#r@F)hkydj^07ZBK۵&M J6`o!ӉCTFpͣw]7{IWzu:V+)&#9LcPTJO;)A&H}m&G6͎pǑ!i^\XH=UVGφ/ŃX[}t+{O7\ϊ,nx&`0}E ;HVpk<||{rS$SbHBR\q Q ] n |i *Q,q T]įqʠ8^$:vsd _lr'Ron\m)lqœ#rläMT%;D64 !ڏbB_4 |AEc+SH{Ko!>Zc,ߟJ6QYuƃ=uL~/bIG5dZ6u߯/&2GfT`F# qFNoT')Uގb*?(>dGVC7r_t Oȃs{ DK --QET];7u%w ~tx甩kbn :{SH%CwT9ZXa{FB&G)ICJ6cq-! 7i7r֭rb@ZzUм>wo{-Uz% {xQ 6qwX1!ԊM -y4-jvg#o3o/4~,w|誧 ]n+f/x 4 &$Ҁ%D]e-")#צ. n;@J,Rj4->7 ȹJ~DH,^z6X0%*蘜)U3>]Ta-5N4Bd^VhZ?3t '-V^4@xW@9*DolKads qksh) }`jn^1K ԫmk 18ALLJ"ӧ7$}B2s5e~*s9^%X'L Ƥ],be3er(5}MM{;(kPn%(88t5Eȥ0^ rld#gþ@@8%#VH'7\5=>s[Gd0HnrOw^H0!u.Kq++9&X&Y"ə`2WC~GJ=&Wb-ؠKp;IyOMØ q9oxH\ĸl&1F9=q [*Z[Ł%b%"B|oiu̝>`xk*QH̹/}6R4W^ Tyw¹e}GvAR񬬔7G)yZh{`8pGbz%%y\ #o^U[8 oI4k^Yͧnc_jMN/K9KatJ(3?IR`>NUړ\@91$ro)xt]J67f\yܑWA2 sSK gD$Y/~o3olyԘi!+hM0#Oqkt6'zwUD"d{4$A9!Cۣ<'9RHg9eaBa}/C|^II7S6)z%o W9Xw-`/ON 坤lJ7ӆ&; 9xϴxQZ̤;h6]-9Z yrBx h5Di>2|j5m8| |wc IpǽXeڈRZW_|Du׉_|Nvz1k QLp:#]ӏK"mu#;w !b)^O#qq,`ȀID"T np7LJUB=`p®1Z)* :^{#2{i*3h{_֚k,yc<8CT'gcPƔ j0IH:\Y_x~LY89lFT?!PI1^#.`Sٕ)*xe:%$d XC,@eF#XO,-JA~8}6׎ST6V%l v3_Il 8 Eomm\6(ܝ'5fN]N Xo(:43YU2xDR&SeaԬ %0דC (\k3_&zի/j+q,H߼oLJ\=SV@҆Hߤ4v⦿asoۿ :Ҭ[at(^I3"q/,/{OkJ&/fgrA?jY(m~2tWbTLmJѐ^gD^7S  *]EhY>o4O#F~ |Fv:L8[^|6oٽ).D< yiulH?sSF+|I羢ON?ir@Α#ۮQ['#^-]VvTy=<+YgkRьAȋOOP.F!͇^ږ&-I:g34fEػX4ihf>fG #ج7K>DR}%H1>hԏfJ6, 3"DG  *-o^:bu*Rc J mK΂[q|ngSzb'0ǁ3ǫzVX B㟙K]@hcTf=e.ZG8t9QgtϽ](ಲQdg,.',.Cs'i1  Њ'Hr{vuUw#Fͭv$1`Az}K.3ήKuqu"T́kYE=#RgB<Qz'#mea[I BͿ6 HSu,p7"0CeOsjآCJbۈ=%?_#QI[z25۷'S⧻UZlGV|ITzt QttDh8)ZEsDz >;wh) HXt˭,m=RTrIpŝ(J$uiر6. |Ϣ.fѳSxy:3;